NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102781

Metagenome / Metatranscriptome Family F102781

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102781
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 42 residues
Representative Sequence MLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGEAPPAKR
Number of Associated Samples 88
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.45 %
% of genes near scaffold ends (potentially truncated) 41.58 %
% of genes from short scaffolds (< 2000 bps) 71.29 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.782 % of family members)
Environment Ontology (ENVO) Unclassified
(34.653 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(64.356 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 47.14%    β-sheet: 0.00%    Coil/Unstructured: 52.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF02863Arg_repressor_C 20.79
PF07332Phage_holin_3_6 18.81
PF01316Arg_repressor 15.84
PF03631Virul_fac_BrkB 3.96
PF00903Glyoxalase 2.97
PF10400Vir_act_alpha_C 1.98
PF07992Pyr_redox_2 1.98
PF00676E1_dh 1.98
PF03147FDX-ACB 1.98
PF09939DUF2171 1.98
PF12277DUF3618 0.99
PF11361DUF3159 0.99
PF00116COX2 0.99
PF08840BAAT_C 0.99
PF05198IF3_N 0.99
PF02779Transket_pyr 0.99
PF00027cNMP_binding 0.99
PF04055Radical_SAM 0.99
PF00583Acetyltransf_1 0.99
PF03551PadR 0.99
PF00201UDPGT 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1438Arginine repressorTranscription [K] 36.63
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 3.96
COG0072Phenylalanyl-tRNA synthetase beta subunitTranslation, ribosomal structure and biogenesis [J] 1.98
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 1.98
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 1.98
COG1819UDP:flavonoid glycosyltransferase YjiC, YdhE familyCarbohydrate transport and metabolism [G] 1.98
COG0290Translation initiation factor IF-3Translation, ribosomal structure and biogenesis [J] 0.99
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.99
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.99
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.99
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.99
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.01 %
UnclassifiedrootN/A0.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_10028331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300002568|C688J35102_120608000All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300002568|C688J35102_120643883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1286Open in IMG/M
3300004114|Ga0062593_102154155All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300004480|Ga0062592_101384179All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005175|Ga0066673_10026168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2753Open in IMG/M
3300005179|Ga0066684_10329980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300005187|Ga0066675_10175421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1489Open in IMG/M
3300005332|Ga0066388_104756583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300005434|Ga0070709_10135403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1687Open in IMG/M
3300005451|Ga0066681_10006607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5433Open in IMG/M
3300005451|Ga0066681_10832694All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005549|Ga0070704_100044747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3078Open in IMG/M
3300005553|Ga0066695_10343287All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300005554|Ga0066661_10354020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales899Open in IMG/M
3300005558|Ga0066698_10275175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1165Open in IMG/M
3300005566|Ga0066693_10087920All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300005566|Ga0066693_10466185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300005574|Ga0066694_10501832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300005577|Ga0068857_100316629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1440Open in IMG/M
3300005598|Ga0066706_10066286All Organisms → cellular organisms → Bacteria2508Open in IMG/M
3300005764|Ga0066903_100363767All Organisms → cellular organisms → Bacteria2350Open in IMG/M
3300005764|Ga0066903_103086404All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300006031|Ga0066651_10009131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3960Open in IMG/M
3300006032|Ga0066696_10093739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1790Open in IMG/M
3300006046|Ga0066652_100055639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3005Open in IMG/M
3300006844|Ga0075428_100021247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7188Open in IMG/M
3300006846|Ga0075430_101283581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300006904|Ga0075424_101222745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300006954|Ga0079219_10932118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales708Open in IMG/M
3300009156|Ga0111538_12373983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300009789|Ga0126307_10054312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3132Open in IMG/M
3300009840|Ga0126313_11669612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300010036|Ga0126305_10025038All Organisms → cellular organisms → Bacteria3191Open in IMG/M
3300010037|Ga0126304_11158869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300010038|Ga0126315_10817624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300010039|Ga0126309_10041555All Organisms → cellular organisms → Bacteria → Terrabacteria group2154Open in IMG/M
3300010041|Ga0126312_11470826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300010042|Ga0126314_10390675All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300010043|Ga0126380_10087135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1830Open in IMG/M
3300010044|Ga0126310_10000665All Organisms → cellular organisms → Bacteria12197Open in IMG/M
3300010044|Ga0126310_10648275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300010047|Ga0126382_10011521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4268Open in IMG/M
3300010145|Ga0126321_1498437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1178Open in IMG/M
3300010154|Ga0127503_10243460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1174Open in IMG/M
3300010364|Ga0134066_10048589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300010371|Ga0134125_10701990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1115Open in IMG/M
3300012014|Ga0120159_1204565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300012019|Ga0120139_1001300All Organisms → cellular organisms → Bacteria7374Open in IMG/M
3300012198|Ga0137364_10005078All Organisms → cellular organisms → Bacteria6996Open in IMG/M
3300012199|Ga0137383_11178741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300012201|Ga0137365_10007099All Organisms → cellular organisms → Bacteria8936Open in IMG/M
3300012204|Ga0137374_10989556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300012212|Ga0150985_107561518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300012212|Ga0150985_113752298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1198Open in IMG/M
3300012212|Ga0150985_114143079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300012361|Ga0137360_10455011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300012362|Ga0137361_11586333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300012373|Ga0134042_1028388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces830Open in IMG/M
3300012469|Ga0150984_108399684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300012469|Ga0150984_108424072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300012469|Ga0150984_111975463Not Available680Open in IMG/M
3300012951|Ga0164300_10050795All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300012985|Ga0164308_12139344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300015356|Ga0134073_10025914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1443Open in IMG/M
3300015371|Ga0132258_10081649All Organisms → cellular organisms → Bacteria7543Open in IMG/M
3300015371|Ga0132258_11583423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1654Open in IMG/M
3300018064|Ga0187773_10000876All Organisms → cellular organisms → Bacteria12078Open in IMG/M
3300018431|Ga0066655_10143835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1406Open in IMG/M
3300018482|Ga0066669_10049682All Organisms → cellular organisms → Bacteria2640Open in IMG/M
3300019356|Ga0173481_10128904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300019873|Ga0193700_1038039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300019887|Ga0193729_1001778All Organisms → cellular organisms → Bacteria10907Open in IMG/M
3300020012|Ga0193732_1063721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300021344|Ga0193719_10031152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2299Open in IMG/M
3300021445|Ga0182009_10224460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria923Open in IMG/M
3300022195|Ga0222625_1634394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300026116|Ga0207674_12183614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300026306|Ga0209468_1062142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1257Open in IMG/M
3300026308|Ga0209265_1180578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300026316|Ga0209155_1002273All Organisms → cellular organisms → Bacteria8906Open in IMG/M
3300026323|Ga0209472_1072869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1413Open in IMG/M
3300026547|Ga0209156_10246532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300027907|Ga0207428_10156320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1734Open in IMG/M
3300028715|Ga0307313_10002875All Organisms → cellular organisms → Bacteria3890Open in IMG/M
3300028721|Ga0307315_10000374All Organisms → cellular organisms → Bacteria10242Open in IMG/M
3300028744|Ga0307318_10135482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300028768|Ga0307280_10000164All Organisms → cellular organisms → Bacteria12363Open in IMG/M
3300028784|Ga0307282_10032366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2266Open in IMG/M
3300028791|Ga0307290_10008220All Organisms → cellular organisms → Bacteria3483Open in IMG/M
3300028791|Ga0307290_10052123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1475Open in IMG/M
3300028880|Ga0307300_10017141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1885Open in IMG/M
3300028881|Ga0307277_10001778All Organisms → cellular organisms → Bacteria8359Open in IMG/M
3300030902|Ga0308202_1033838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium875Open in IMG/M
3300030905|Ga0308200_1131108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300031058|Ga0308189_10041939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1225Open in IMG/M
3300031058|Ga0308189_10133259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae832Open in IMG/M
3300031058|Ga0308189_10484826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300031093|Ga0308197_10367905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300031229|Ga0299913_10001486All Organisms → cellular organisms → Bacteria17428Open in IMG/M
3300031854|Ga0310904_10979693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.81%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil9.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.97%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1002833123300000953SoilMLRKLLWSTLYGGLAAGFALAARQGASVAWRLATGESPPAKR*
C688J35102_12060800033300002568SoilMLRKLLWSTLYAGLAAGSALVARQAASRIWRLTTGESPPAKR*
C688J35102_12064388323300002568SoilMMLRRLLWSTLYAGLAAGTALVARQTASRIWRLATGEPPPTKR*
Ga0062593_10215415523300004114SoilMLRKLLYSALYAGLAAGSALVARSAASRIWRLATGEAPPVKR*
Ga0062592_10138417923300004480SoilMLRKLLWSGLYAGLAAGGAVVARLVATRIWKMATGEDPPEKR*
Ga0066673_1002616833300005175SoilMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGESPPAKR*
Ga0066684_1032998023300005179SoilMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGEAPPAKR*
Ga0066675_1017542113300005187SoilRRGKQPTMLRKVLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR*
Ga0066388_10475658323300005332Tropical Forest SoilMLRKLLWSTLYTGLAAGFALAARQAASTGWRLATGEAPPAKR*
Ga0070709_1013540323300005434Corn, Switchgrass And Miscanthus RhizosphereMLRKLLYSGLYAGLAAGSALVARSAASRIWRLATGEAPPVKR*
Ga0066681_1000660753300005451SoilMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGEPPPAKR*
Ga0066681_1083269423300005451SoilMLRKLLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR*
Ga0070704_10004474733300005549Corn, Switchgrass And Miscanthus RhizosphereMLRKLLYSALYAALAAGSALVARSAASRIWRLATGEAPPVKR*
Ga0066695_1034328713300005553SoilKQANMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGEPPPAKR*
Ga0066661_1035402033300005554SoilKLLYSALYAGLAAGSALVARSAASRIWRLATGEAPPVKR*
Ga0066698_1027517543300005558SoilWSGLYAGLAAGSALAARQAATRIWRLATGESPPAKR*
Ga0066693_1008792013300005566SoilMLRKVLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR*
Ga0066693_1046618523300005566SoilGRRGKQPTMLRKVLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR*
Ga0066694_1050183213300005574SoilLLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR*
Ga0068857_10031662913300005577Corn RhizosphereKLLWSGLYAGLAAGGAVVARLVATRIWKMATGEDPPEKR*
Ga0066706_1006628653300005598SoilVLRKLLWSGLYAGLAAGSAWPHDRLHHIWRLATGEEPPAAMSKAD
Ga0066903_10036376713300005764Tropical Forest SoilLTWSALYAGLAAGAAMIARLIATRIWKLLTGEDPPVKR*
Ga0066903_10308640423300005764Tropical Forest SoilMLRKLLWSGLYAGLAAGAAVVARLVAARVWRLATGEDPPEKR*
Ga0066651_1000913143300006031SoilMLRKLLWSTLYAGLAAGSALVARQAATRIWRLTLGEDPPVRR*
Ga0066696_1009373913300006032SoilGKQANMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGESPPAKR*
Ga0066652_10005563913300006046SoilMLRKLLWSTLYAGLAAGSGLAARQAATRIWRLTLGEDPPVRR*
Ga0075428_10002124783300006844Populus RhizosphereMLRKVLWSTLYTGFAAGFALAARQAAAVGWRLATGETPPEKR*
Ga0075430_10128358113300006846Populus RhizosphereIWAGLYAGLAAGAALVARLIASRIWRLATGEDPPDRR*
Ga0075424_10122274533300006904Populus RhizosphereMLRKVLWSTLYTGFAAGFALAARQAAAVGWRLATGET
Ga0079219_1093211833300006954Agricultural SoilLWSTLYTGFAAGFALAARQAAAVGWRLATGETPPEKR*
Ga0111538_1237398333300009156Populus RhizosphereMLRKLLWSGLYAGLAAGAAVITRFIASRIWRLATGDDPPEKR*
Ga0126307_1005431223300009789Serpentine SoilMLRKLLWSGLYAGLAAGGAVVARLVASRIWRLATGEDPPEKR*
Ga0126313_1166961223300009840Serpentine SoilMLRKLLWSGIYAGLAAGAAIVARTVATKIWTASTGEEPPAKR*
Ga0126305_1002503863300010036Serpentine SoilMLRKLLWSGLYAGLAASAAVMTRFIAARIWRLATGEDPPEKR*
Ga0126304_1115886913300010037Serpentine SoilMLRKLLWSGLYAGLAASAAVMTRFIAARIWRLATGEDPPEK
Ga0126315_1081762423300010038Serpentine SoilMLRKLLWSGLYAGLAAGGAVVARLVATRIWRLATGEDPPEKR*
Ga0126309_1004155543300010039Serpentine SoilMLRKLLWSGIYAGLAAGAAIVARTVATKIWTVSTGEEPPAKR*
Ga0126312_1147082613300010041Serpentine SoilMLRKLLWSGIYASLAAGAAVVARTVASKIWTASTGEERGAL
Ga0126314_1039067533300010042Serpentine SoilMLRRLLWSGIYAGLAAGAAMVARTVATRVWMLATG
Ga0126380_1008713543300010043Tropical Forest SoilMLRKVLWSTLYTGLAAGFALAARQGASAVWRLATGESPPAKR*
Ga0126310_1000066583300010044Serpentine SoilVLRKLLWSSLYAGLAAGSALAARQAASRIWRLTTGESPPAK*
Ga0126310_1064827523300010044Serpentine SoilMLRKLLWSGLYAGLAAGAAVITRFIASRIWRLATGDEPPEKR*
Ga0126382_1001152183300010047Tropical Forest SoilMLRKLLWSVLYAGLAAGSALVAKRVASTIWRLATGEAPPVKQ*
Ga0126321_149843743300010145SoilLWSGLYAGLAAGAAVVSQKVAARAWRLATGDEPPAKR*
Ga0127503_1024346043300010154SoilASTPKMLRKLLYSALYAGLAAGSALVARSAASRIWRLATGEAPPVKR*
Ga0134066_1004858923300010364Grasslands SoilMLRKVLWSTLYTGLAAGFALAARQGASVARRLATGETPPEKR*
Ga0134125_1070199023300010371Terrestrial SoilMLRKLLWSGLYAGLAGGIALVTRQAATRIWRLATGEAPPAKR*
Ga0120159_120456523300012014PermafrostMLRKLMWSGLYASLAAGAAMVARLIATKIWRAATGEDPPDKR*
Ga0120139_100130053300012019PermafrostMLRKLLWSGLYASLAAGAAMIARMVATRIWHAATGEDPPEKR*
Ga0137364_1000507883300012198Vadose Zone SoilMLRKLLWSTLYAGLAAGSGLAARQAATRIWRLTLGEDPPARR*
Ga0137383_1117874123300012199Vadose Zone SoilMLRKLLYSALYTGLAAGSALVARSAASRIWRLATGEAPPVKR*
Ga0137365_10007099113300012201Vadose Zone SoilMLRKLLYSGLYAGLAAGSAFVARSAASRIWRLATGEAPPVKR*
Ga0137374_1098955613300012204Vadose Zone SoilMLRKLLWSGLYAGLAAGAAIAARTIASKIWRVTTGEEPPAKR*
Ga0150985_10756151813300012212Avena Fatua RhizosphereTMLRKLLWSGLYAGLAAGVALVSRQAATKIWRLATGEAPPAKR*
Ga0150985_11375229843300012212Avena Fatua RhizosphereRKLMWSGLYAGLAAGGAMVAKLVATRIWRMATGEDPPEKR*
Ga0150985_11414307943300012212Avena Fatua RhizosphereKLLWSGLYAGLAAGAAVITRFIASRIWRLATGDDPPEKR*
Ga0137360_1045501113300012361Vadose Zone SoilMLRKLLYSALYAGLAAGSALVARSAASRIWRLATGE
Ga0137361_1158633323300012362Vadose Zone SoilMLRKLLYSALYAGLAAGSALAARSAASRIWRLATGEAPPVKR*
Ga0134042_102838823300012373Grasslands SoilPTMLRKVLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR*
Ga0150984_10839968413300012469Avena Fatua RhizosphereLLWSALYAGVAAGIALVSRQAATRIWRLATGEAPPAKR*
Ga0150984_10842407223300012469Avena Fatua RhizosphereLLWSTLYAGLAAGSALVARQTAARIWRLTLGEDPPARR*
Ga0150984_11197546313300012469Avena Fatua RhizosphereLFRSLMWSGLYAGLAAGGAMVAKLVATRIWRMATGEDPPEKR*
Ga0164300_1005079533300012951SoilMLRKLLWSGLYAGLAAGAAVITRFIAARVWRLATGEDPPEKR*
Ga0164308_1213934423300012985SoilGKHTKMLRKLLYSGVYAGLAAGSALVARSAASRIWRLATGEAPPVKR*
Ga0134073_1002591413300015356Grasslands SoilMLRKLLWSGLYAGIAAGSALAARQAATRIWRLATGEAPPAKR*
Ga0132258_1008164983300015371Arabidopsis RhizosphereMLRKLLWSVMYTGLAAGFALVARQGASAAWRLATGERPPEKR*
Ga0132258_1158342323300015371Arabidopsis RhizosphereMLRKLMWSGLYAGLAAGGAFVARLVATRIWRLATGEDPPEKR*
Ga0187773_1000087613300018064Tropical PeatlandVLRKLLWTGLYTGLAAGATLAARRAASKIWTLATGEAPP
Ga0066655_1014383523300018431Grasslands SoilMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGEAPPAKR
Ga0066669_1004968253300018482Grasslands SoilMLRKLLWSILYAGLAAGSGLAARQAATRIWRLTLGEDPPERR
Ga0173481_1012890433300019356SoilMLRKLLWSGLYAGLAAGGAVVARLVATRIWKMATGEDPPEKR
Ga0193700_103803913300019873SoilLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPAKR
Ga0193729_1001778113300019887SoilMLRKLLYSGLYAGLAAGSALVARRAAATVWRLATGEAPPVKR
Ga0193732_106372133300020012SoilARQPTMLRKLLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPAKR
Ga0193719_1003115213300021344SoilMLRKLLWSGLYAGLAAGATMVARTAATRIWRAATGEPPPVKR
Ga0182009_1022446023300021445SoilMLRKVLWSTLYSGLAAGFALAARQAASVGWRLATGETPPEKR
Ga0222625_163439433300022195Groundwater SedimentLLWSGLYAVLSAGAAVAARRMASRIWQLATGEQPPAKR
Ga0207674_1218361413300026116Corn RhizosphereKLLWSGLYAGLAAGGAVVARLVATRIWKMATGEDPPEKR
Ga0209468_106214223300026306SoilMLRKVLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR
Ga0209265_118057823300026308SoilMLRKLLWSTLYTGLAAGFALAARQAASVGWRLATGETPPEKR
Ga0209155_1002273113300026316SoilMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGESPPAKR
Ga0209472_107286923300026323SoilMLRKLLWSGLYAGLAAGSALAARQAATRIWRLATGEPPPAKR
Ga0209156_1024653223300026547SoilMLRKLLWSGLYAGLAAGSALAARRAATGIWRLATGEPPPTKR
Ga0207428_1015632033300027907Populus RhizosphereMLRKVLWSTLYTGFAAGFALAARQAAAVGWRLATGETPPEKR
Ga0307313_1000287563300028715SoilMLRKLLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPAKR
Ga0307315_10000374113300028721SoilMLRKLLWSGLYAGLAAGIALVSRQAATRVWRLATGEAPPAKR
Ga0307318_1013548223300028744SoilMLRKLLWSGLYAGLAAGGAVVARLVATRIWKMATGEDPPKKR
Ga0307280_10000164113300028768SoilMLRKLLWSGLYAGLAAGIALASRQAAIRVWRLATGEAPPAKR
Ga0307282_1003236643300028784SoilMLRKLLWSTLYAGLAAGSALVARRAASGIWRLATGE
Ga0307290_1000822063300028791SoilMLRKLLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPA
Ga0307290_1005212313300028791SoilSEARQPTMLRKLLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPAKR
Ga0307300_1001714123300028880SoilMLRKLLWSGLYAGLAAGVALVSRQAATRIWRLATGEAPPAKR
Ga0307277_1000177853300028881SoilMLRKLLWSSLYAGLAAGSALAARQAASRIWRLTTGESPPAKR
Ga0308202_103383813300030902SoilLLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPAKR
Ga0308200_113110813300030905SoilRQPTMLRKLLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPAKR
Ga0308189_1004193913300031058SoilGSEARQPTMLRKLLWSGLYAGLAAGIALASRQAATRVWRLATGEAPPAKR
Ga0308189_1013325933300031058SoilLLWSGLYAGLAAGAAVITRFIASRIWRLATGDDPPEKR
Ga0308189_1048482623300031058SoilLWSGLYAGLAAGGAVVARLVATRIWKMATGEDPPEKR
Ga0308197_1036790523300031093SoilLLWSGLYAGLAAGGAVVARLVATRIWKMATGEDPPKKR
Ga0299913_10001486203300031229SoilVLLRKLMWSGLYAGLAAGSAMAARRLASKIWRVTTGEAPPTKK
Ga0310904_1097969333300031854SoilSGLYAGLAAGSALVARRAASGIWRLATGEAPPEKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.