Metagenome Family F102740

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F102740
Family Type	Metagenome
Number of Sequences	101
Average Sequence Length	39 residues
Representative Sequence	MSALGQKQTYALQKAMSALPPIATAKADIRKRSCPLYP
Number of Associated Samples	72
Number of Associated Scaffolds	101

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	66.67 %
% of genes near scaffold ends (potentially truncated)	2.97 %
% of genes from short scaffolds (< 2000 bps)	2.97 %
Associated GOLD sequencing projects	68
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model
Column number x ScaleMaximum Observed Maximum Theoretical Color SchemeDefault Consensus Colors CoordinatesModel Alignment

Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (98.020 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (20.792 % of family members)
Environment Ontology (ENVO)	Unclassified (40.594 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (54.455 % of family members)

Multiple Sequence Alignments

Select alignment to view:

Full Alignment
Alignment of all the sequences in the family.
ID â†‘ ID â†“ Label â†‘ Label â†“ Seq â†‘ Seq â†“ Identity â†‘ Identity â†“ Gaps â†‘ Gaps â†“ Consensus to top Sorting Hide columns by threshold Hide columns by selection Hide columns by gaps Hide seqs by identity Hide seqs by selection Hide seqs by gaps Reset Filter Find Motif (supports RegEx) Invert columns Invert rows Reset Selection Hide residues indices Hide ID/Label Show meta info (Gaps/Ident) Show overview panel Show sequence logo Show gap weights Show conservation weights Show scale slider Hide Label Hide ID Hide gaps % Hide identity score Reset Vis.elements Taylor Buried Cinema Clustal Clustal2 Helix Hydrophobicity Lesk MAE Nucleotide Purine PID Strand Turn Zappo No color Color scheme Add consensus seq Jump to a column Extras Share view (URL)â†ª View in Jalview Export alignment (FASTA) Export alignment (URL) Export selected sequences (FASTA) Export features (GFF) Export MSA image (PNG) Export About the project Report issues User manual Help IDLabel
Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.
ID â†‘ ID â†“ Label â†‘ Label â†“ Seq â†‘ Seq â†“ Identity â†‘ Identity â†“ Gaps â†‘ Gaps â†“ Consensus to top Sorting Hide columns by threshold Hide columns by selection Hide columns by gaps Hide seqs by identity Hide seqs by selection Hide seqs by gaps Reset Filter Find Motif (supports RegEx) Invert columns Invert rows Reset Selection Hide residues indices Hide ID/Label Show meta info (Gaps/Ident) Show overview panel Show sequence logo Show gap weights Show conservation weights Show scale slider Hide Label Hide ID Hide gaps % Hide identity score Reset Vis.elements Taylor Buried Cinema Clustal Clustal2 Helix Hydrophobicity Lesk MAE Nucleotide Purine PID Strand Turn Zappo No color Color scheme Add consensus seq Jump to a column Extras Share view (URL)â†ª View in Jalview Export alignment (FASTA) Export alignment (URL) Export selected sequences (FASTA) Export features (GFF) Export MSA image (PNG) Export About the project Report issues User manual Help IDLabel
Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.
ID â†‘ ID â†“ Label â†‘ Label â†“ Seq â†‘ Seq â†“ Identity â†‘ Identity â†“ Gaps â†‘ Gaps â†“ Consensus to top Sorting Hide columns by threshold Hide columns by selection Hide columns by gaps Hide seqs by identity Hide seqs by selection Hide seqs by gaps Reset Filter Find Motif (supports RegEx) Invert columns Invert rows Reset Selection Hide residues indices Hide ID/Label Show meta info (Gaps/Ident) Show overview panel Show sequence logo Show gap weights Show conservation weights Show scale slider Hide Label Hide ID Hide gaps % Hide identity score Reset Vis.elements Taylor Buried Cinema Clustal Clustal2 Helix Hydrophobicity Lesk MAE Nucleotide Purine PID Strand Turn Zappo No color Color scheme Add consensus seq Jump to a column Extras Share view (URL)â†ª View in Jalview Export alignment (FASTA) Export alignment (URL) Export selected sequences (FASTA) Export features (GFF) Export MSA image (PNG) Export About the project Report issues User manual Help IDLabel
Powered by MSAViewer

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61%
Feature Viewer
Position : 0 Zoom : x 1 + Add Multiple Variants Enter the variants Position Original Variant Get Predictions Get Predictions Enter the variants Position Original Variant A / Ala R / Arg N / Asn D / Asp C / Cys E / Glu Q / Gln G / Gly H / His I / Ile L / Leu K / Lys M / Met F / Phe P / Pro S / Ser T / Thr W / Trp Y / Tyr V / Val
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
WebGL does not seem to be available. This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser. For a list of supported browsers, refer to http://caniuse.com/#feat=webgl. Load File(s)

Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.23
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF04392	ABC_sub_bind	40.59
PF13185	GAF_2	4.95
PF00480	ROK	1.98
PF02518	HATPase_c	1.98
PF00561	Abhydrolase_1	0.99
PF03734	YkuD	0.99
PF00126	HTH_1	0.99
PF13924	Lipocalin_5	0.99
PF13618	Gluconate_2-dh3	0.99
PF00884	Sulfatase	0.99

Showing 1 to 10 of 25 entries

Previous1 2 3Next

COG ID	Name	Functional Category	% Frequency in 101 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	40.59
COG1940	Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain	Transcription [K]	3.96
COG3835	Sugar diacid utilization regulator CdaR	Transcription [K]	1.98
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.99
COG1272	Predicted membrane channel-forming protein YqfA, hemolysin III family	Intracellular trafficking, secretion, and vesicular transport [U]	0.99
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.99
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.99
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.99
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	0.99
COG3672	Predicted transglutaminase-like protein	Posttranslational modification, protein turnover, chaperones [O]	0.99

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	1.98 %
Unclassified	root	N/A	98.02 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	1.98 %
Unclassified	root	N/A	98.02 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.98 %
Unclassified	root	N/A	98.02 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.99 %
Unclassified	root	N/A	98.02 %

Visualization
Download SVG Download PNG Download CSV
Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300015373\|Ga0132257_101902868	Not Available	766	Open in IMG/M
3300025932\|Ga0207690_10289954	All Organisms → cellular organisms → Bacteria	1277	Open in IMG/M
3300025945\|Ga0207679_10336705	All Organisms → cellular organisms → Bacteria → Proteobacteria	1311	Open in IMG/M

Showing 1 to 3 of 3 entries

Previous1Next

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.37%
Host-Associated	Host-Associated	36.63%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	36.63%
Terrestrial	Environmental → Terrestrial	63.37%

Habitat	Taxonomy	Distribution
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.90%
Rhizosphere	Host-Associated → Plants → Rhizosphere	26.73%
Soil	Environmental → Terrestrial → Soil	63.37%

Habitat	Taxonomy	Distribution
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.95%
Loam	Environmental → Terrestrial → Soil → Loam	21.78%
Soil	Host-Associated → Plants → Rhizosphere → Soil	11.88%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	40.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.95%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.99%

Habitat	Taxonomy	Distribution
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.98%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.98%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.97%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	18.81%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.89%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.98%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	11.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.95%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.99%

Habitat	Taxonomy	Distribution
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.95%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.98%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.99%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.98%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.98%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.98%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.99%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.98%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.92%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	1.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.98%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.99%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.99%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	20.79%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	18.81%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.99%

Visualization
Download SVG Download PNG Download CSV
Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old	Host-Associated	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M

Showing 1 to 10 of 72 entries

Previous1 2 3 4 5…8Next

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ARSoilOldRDRAFT_0001521	3300000044	Arabidopsis Rhizosphere	MKTTSALGQKQTYALQKAMSALPPIATAKADSRKRS
ICChiseqgaiiFebDRAFT_144385321	3300000363	Soil	MSALGHEQTFALHNRMSAFPIATAKADFGNLSCLLS
AF_2010_repII_A100DRAFT_10218971	3300000655	Forest Soil	FYGSSADRAMSALGHKQTYAAQNGMSALAPLATAKAEFRKRSCPLYP*
JGI11643J12802_107524942	3300000890	Soil	MLFRKMSTLGHKPAFRSAIVMSALPPIATAKADSRKRSC
Ga0062593_1004896333	3300004114	Soil	MSALGHKRTFAPQHVTSALPPIATAKADFGKPSCLVYPQEQTCAV*
Ga0062595_1001433212	3300004479	Soil	MILWRPMSALGHKQTYALQKAMSAITPIATAKADIGRLSCLLYP
Ga0070676_101931341	3300005328	Miscanthus Rhizosphere	MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLRKRTC
Ga0066388_1014846731	3300005332	Tropical Forest Soil	MSALGQKRTYAVQNGMSALPPKATAKADIRKRSCLLYTRKRTC
Ga0066388_1021824133	3300005332	Tropical Forest Soil	ANSGILRRGMMSALGQKQTCALQNVMSAVPPTATAKADIGNPSCLLYPQ*
Ga0066388_1030837782	3300005332	Tropical Forest Soil	MSALGQKQTYAAHKLMSALPPIATKKADIGNLSCLLYPQ*
Ga0068859_1019411462	3300005617	Switchgrass Rhizosphere	MSALGHKQTFALRNAMSALPPKATAKADIRKRSCPL
Ga0066905_1002135542	3300005713	Tropical Forest Soil	MSALGQKQTFAAQKVMSALPPKATAKADFGNPSCLLYPQ*
Ga0066905_1002168263	3300005713	Tropical Forest Soil	MSALGQKQTYASQQAMSALPPIATAKADIGNPSCLLYPR
Ga0066905_1002903852	3300005713	Tropical Forest Soil	MSALGQKQTCALQNVMSALLPIATTKADIGKPSCLLYP
Ga0066905_1003130092	3300005713	Tropical Forest Soil	MSALGHKQTYALQKAMSALPPIATAKADFGKPPCLLYP*
Ga0066905_1008767322	3300005713	Tropical Forest Soil	MSALGQKQTHAVQQRMSALPPIATAKADMSLASCPLFP
Ga0066905_1012029891	3300005713	Tropical Forest Soil	GQKQTHAVQQRMSASPPIATVKADIRKRSCLLYPQKQTCAVH*
Ga0066905_1014432401	3300005713	Tropical Forest Soil	SALGHKQTYAVQQPMSALPPIATAKADSCKQSCLLYP*
Ga0066903_1003561932	3300005764	Tropical Forest Soil	MSALGQKQTYAAHKLMSALPPIATAKADFPQKSCLLYP
Ga0066903_1008920353	3300005764	Tropical Forest Soil	MSALGHKQTYAAHKLMSALPPIATAKADPRKVMSALP
Ga0066903_1015165152	3300005764	Tropical Forest Soil	VMSALGKKRAYAAHKVMSALPMIATAKADSRNRSCLLY
Ga0066903_1019914481	3300005764	Tropical Forest Soil	MSALGHKQTYAVQQTMSASPPIATSKADIRKRSCPLYPESGHVRRK*
Ga0066903_1026649922	3300005764	Tropical Forest Soil	MSALGQKQTYALQKAMSALPPIATMKADIGKPSGLLYP
Ga0066903_1039124472	3300005764	Tropical Forest Soil	MSALGQKQTYALQKAMSALPPIATAKADMTVCGCLLYP
Ga0066903_1040993582	3300005764	Tropical Forest Soil	MSALGQKQTYALQKAMSALPPIATAKADIRKRSCPLYP
Ga0066903_1057230701	3300005764	Tropical Forest Soil	MSALGQKQTYAMQKRMSALAPIATAKADVAQKSCLLYPQ
Ga0066903_1059508421	3300005764	Tropical Forest Soil	LGQKQTYAAHKLMSALPPIATAKADFRKRSCPLYP
Ga0068858_1020500091	3300005842	Switchgrass Rhizosphere	MSALGHKQTYAVQKAMSASPLIATAKADLRKKRTCAAQQVMSALGQ
Ga0075417_101973742	3300006049	Populus Rhizosphere	MSALGQKQTFAPQKAMSALPPIATAKADSRKRSCPLYP
Ga0075433_116710871	3300006852	Populus Rhizosphere	MSALGHKRTYAVQQAMSALHPIATAKADFRKTSCLLYPGLRSDLP
Ga0075429_1000443851	3300006880	Populus Rhizosphere	MSALGHKRTYAVQKGMSALHPIATAKADFRTSPCPLYP
Ga0075426_110157751	3300006903	Populus Rhizosphere	MSALGHKPAYAVHNVMSAWPPIATAKADIRKGHVCF
Ga0075424_1016489001	3300006904	Populus Rhizosphere	MSALGQKQTFAPQKVMSALPAKVDIRQRSDLMSFRSSIVS
Ga0105245_105170722	3300009098	Miscanthus Rhizosphere	MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLR
Ga0111538_102195904	3300009156	Populus Rhizosphere	MKTTSALGQKQTYALQKAMSALPPIATAKADSRKRSVCF
Ga0075423_112312572	3300009162	Populus Rhizosphere	MSALGHKQTFALQKAMSALPPKATAKADIRKRSCPLHP
Ga0105242_124380071	3300009176	Miscanthus Rhizosphere	MSALGQKLTFAPQQGMSALPPIATAKADIRKTPCLLCP
Ga0105248_109317381	3300009177	Switchgrass Rhizosphere	MSALGHKRTYAPQQAMSAIPPISTAKADIRKSPCPL
Ga0126380_104365411	3300010043	Tropical Forest Soil	MSALGQKQTFEVQKGMSALPRIAIAKADSRNGHVRF
Ga0126380_120772012	3300010043	Tropical Forest Soil	MSALGQKQTYAVQNAMSALPPIATAKADIGKPSCLLYP
Ga0126384_117185552	3300010046	Tropical Forest Soil	MSALGQKQTCARQKAMSALPPIAIAKADFLKRSCPLYPQER
Ga0126382_109070682	3300010047	Tropical Forest Soil	MSALGQKQTYAVQQGMSALPPIATGKADISKRSCLLYA
Ga0126382_113500782	3300010047	Tropical Forest Soil	MSALGQKQTFAVQNGMSALPPIATAKVDFPQTICLTRKAD
Ga0126370_102481221	3300010358	Tropical Forest Soil	MMSALGQKQTYALQKAMSALPPIATAKADIRKRSCLLYPQKR
Ga0126370_125009472	3300010358	Tropical Forest Soil	MSALGQKRTFAVQDGMSALIPIATMKADFRKRSCLLYP
Ga0126376_102120761	3300010359	Tropical Forest Soil	MSALGQKQTCARQKAMSALPPIATAKADFRKSSSLLYPRKRTFTV
Ga0126372_110805682	3300010360	Tropical Forest Soil	LMIVMSALGQKQTCALQNVMSALFPIATAKADFGNPSCLL*
Ga0126372_112554252	3300010360	Tropical Forest Soil	MSALGQKQTYAVQNVMSALPLIATAKANSRKRSSPLH
Ga0126378_106173181	3300010361	Tropical Forest Soil	MSALGQKQTYAVQNGMSALRPKATAKADIRKSLCPLHPQKLT
Ga0126378_133841801	3300010361	Tropical Forest Soil	MSALGQKQTYAPQKGTSALPPIATAKADFGKPSCLLYPQ
Ga0126377_130684901	3300010362	Tropical Forest Soil	VDLLLSRMSALGQKQTYAPQNVMSALPPIATEKADFRKRSC
Ga0126379_101610733	3300010366	Tropical Forest Soil	MSALGHKRTHAAQNGMSALPPIATAKADSRKRSCLLYPH
Ga0126379_104519681	3300010366	Tropical Forest Soil	MSALGQNQTYAVQKAMSALPPIATTKAEIGKTSCPLYP
Ga0126381_1007757841	3300010376	Tropical Forest Soil	MSALGQKQTCALQNVMSALPPIATAKADFRKRSCPLYP
Ga0157318_10349461	3300012482	Arabidopsis Rhizosphere	MSALGQKQTFAAQKAMSALPPIATAKADIRKRSCLLYPQERT
Ga0126375_103434472	3300012948	Tropical Forest Soil	MSALGQKRTYAVHQLMSALPPIATAKADFRKSSCLLYP
Ga0126369_126450922	3300012971	Tropical Forest Soil	QKQTYAAHKLMSALPPIATKKADIGNLSCLLYPQ*
Ga0164305_117388541	3300012989	Soil	MIRSRMSALGHKRTYAVQKSMSALPPIATAKPDISPGKCPLYPRKQT
Ga0157380_101510983	3300014326	Switchgrass Rhizosphere	MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLRKRT
Ga0173483_108734792	3300015077	Soil	MSALGHKQTFAVQKGMSALPPIATAKADFGKPSCLLYPQ
Ga0132258_112277331	3300015371	Arabidopsis Rhizosphere	MSALGHKRTYALQKAMSALPPIATEKADIRKRSYLL
Ga0132256_1018803911	3300015372	Arabidopsis Rhizosphere	MSALGHKPTFALQKAMFALAQTATAKADFRAMSALL
Ga0132257_1018113932	3300015373	Arabidopsis Rhizosphere	MSALGQKQTYAVQNVMSALHPIATEKADFRKRSCPLNPQERT
Ga0132257_1019028683	3300015373	Arabidopsis Rhizosphere	MSALGQERTYAPQQVMSALPPIGTAKADVGNPSCLLYLRKRTCAAQ
Ga0132257_1036455461	3300015373	Arabidopsis Rhizosphere	MSALGQKQICAAHKLMSALPPIATAKADSRKGSCPLKADMC
Ga0132255_1002404313	3300015374	Arabidopsis Rhizosphere	MSAMGHKRTYAVQKGMSALLPIATAKADFGKPSCLLTPE
Ga0182036_105115561	3300016270	Soil	MSALGQKQTYAVQKAMSALPPIATAKADSRKRSCLLYPQKRT
Ga0182033_121473361	3300016319	Soil	MSALGQKQTCALQNVMSALPPIATAKADSRKGVCLLYP
Ga0182035_115974042	3300016341	Soil	MSALGQKRTYAVHNGMSALLPKATAKADSRKGACLLY
Ga0182034_105197642	3300016371	Soil	SALGQKQTYAVHNGMSALPPIATAKADSRKGACLLYPESGHVQCN
Ga0187779_109981582	3300017959	Tropical Peatland	MPALGQKRTFAMQDVMSALPHIATAKADFRKRPCLLYPR
Ga0173482_100120415	3300019361	Soil	VRLSHKQTYAMQKGMSALPLIATAKANSRKGSCLLYP
Ga0126371_104626502	3300021560	Tropical Forest Soil	MPTMSALGQKQTYAAHKLMSALPPIATPKADSRKRPCPLYPRK
Ga0126371_106490661	3300021560	Tropical Forest Soil	MSALGHKQTCAARNGMSALPPKATAIANFRKNHVRF
Ga0126371_119733552	3300021560	Tropical Forest Soil	MSALGHKQTYALQNAMSALSPIATAKADLRTTSCLLYTRKQT
Ga0207645_100687001	3300025907	Miscanthus Rhizosphere	MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPL
Ga0207671_107244782	3300025914	Corn Rhizosphere	MSALGQKQTYALQKAMSALPPIATAKADFGNPSCLLYP
Ga0207671_108041551	3300025914	Corn Rhizosphere	MSALGQKPTYELQQAMSALPPIATAKADMCLRSCLLYP
Ga0207693_106233331	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MFTEDVQMSALGQRRTYAAHKLMSAFPPIATAKADMPH
Ga0207662_105399911	3300025918	Switchgrass Rhizosphere	MSALGQKRTYALQKAMSALPPKATAKADIRKTSCLLYLRKR
Ga0207650_107551102	3300025925	Switchgrass Rhizosphere	MSALGRKRTYAVQKGMSALLPIATVKADSRKRSCLL
Ga0207690_102899542	3300025932	Corn Rhizosphere	MSALGQKPTCALQNLMSALHPIATAKADIRKTPCLLYPRKRT
Ga0207669_100135714	3300025937	Miscanthus Rhizosphere	MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCPLCLRKRTCAV
Ga0207679_103367052	3300025945	Corn Rhizosphere	MSALGQKPTCALQNLMSALHPIATAKADIRKTPCLLYPRKR
Ga0207712_103530881	3300025961	Switchgrass Rhizosphere	MSALGQKRTYALQKATSALPPKATAKADIRKTSCLLYL
Ga0207668_105058562	3300025972	Switchgrass Rhizosphere	MSALGQKQTYAVQEGMSALSPIATAKADFRKTSCLLAP
Ga0207658_109295222	3300025986	Switchgrass Rhizosphere	MSALGHKQTYAVQKAMSASPLIATAKADLRKKRTCAA
Ga0207708_105435682	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	LGHKQTFAVQKGMSALPPIATAKADFGKPSCLLYP
Ga0209481_103198931	3300027880	Populus Rhizosphere	MSALGQKQTFALQKAMSPLPPIATVKADIRKRSCLLSLRKR
Ga0268265_112933632	3300028380	Switchgrass Rhizosphere	MSALGQKQTCAPQKSMSALVPVATAKADMSLASCPLFPRKRT
Ga0268265_113837932	3300028380	Switchgrass Rhizosphere	MSAWGHKQTYAPQKAMSALPRIATAKADSRKGACLPNP
Ga0310893_103544422	3300031892	Soil	MSALGHKQTYAPQKAMSALPRIATAKADSRKGACLP
Ga0310916_111713452	3300031942	Soil	MFALGQKQTYAVQNVMSALAPLATAKADSRKQSCPLYPQKQTC
Ga0310913_104225481	3300031945	Soil	MSALGQKQTFASQNGMSALPPIATAKADFRKRSCL
Ga0310913_112507151	3300031945	Soil	LHSSNPELLMSALGQKPTYAAHKGMSALPPIATAKADFGKPSCPLY
Ga0306922_108356212	3300032001	Soil	MSALGQKQTYAVHKRMSALPPKATAKADIRESSCL
Ga0318504_105327892	3300032063	Soil	MSALGQKQTFASQNGMSALPPIATAKADFRKRSCLLYPQKQT
Ga0310896_106460811	3300032211	Soil	MSALGQKRTCAVQEAMSALLPIATEKADIRKTSCLLYPR
Ga0306920_1038460501	3300032261	Soil	ALGQKQTYALQKAMSALPPIATAKADFRNRACLLCSALANVC
Ga0373948_0207661_2_124	3300034817	Rhizosphere Soil	MSALGQKRTYAAHKSMSALPPIATAKADIGKLSCLLYPRKR
Ga0373958_0137755_498_602	3300034819	Rhizosphere Soil	MSALGQKQTCAPQNAMSALPLIATAKADIRKRSCP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters