NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102459

Metagenome / Metatranscriptome Family F102459

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102459
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 40 residues
Representative Sequence VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS
Number of Associated Samples 92
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 20.79 %
% of genes near scaffold ends (potentially truncated) 11.88 %
% of genes from short scaffolds (< 2000 bps) 81.19 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(21.782 % of family members)
Environment Ontology (ENVO) Unclassified
(37.624 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.614 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.84%    β-sheet: 0.00%    Coil/Unstructured: 81.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00578AhpC-TSA 59.41
PF00296Bac_luciferase 3.96
PF01546Peptidase_M20 2.97
PF13669Glyoxalase_4 1.98
PF00171Aldedh 1.98
PF13193AMP-binding_C 1.98
PF02515CoA_transf_3 0.99
PF064393keto-disac_hyd 0.99
PF00015MCPsignal 0.99
PF13343SBP_bac_6 0.99
PF02518HATPase_c 0.99
PF00753Lactamase_B 0.99
PF08541ACP_syn_III_C 0.99
PF09995MPAB_Lcp_cat 0.99
PF08534Redoxin 0.99
PF01261AP_endonuc_2 0.99
PF12773DZR 0.99
PF10091Glycoamylase 0.99
PF07969Amidohydro_3 0.99
PF03372Exo_endo_phos 0.99
PF00486Trans_reg_C 0.99
PF02771Acyl-CoA_dh_N 0.99
PF01243Putative_PNPOx 0.99
PF02424ApbE 0.99
PF05235CHAD 0.99
PF00923TAL_FSA 0.99
PF00873ACR_tran 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 3.96
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.98
COG0840Methyl-accepting chemotaxis protein (MCP)Signal transduction mechanisms [T] 1.98
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.98
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.98
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.99
COG1477FAD:protein FMN transferase ApbEPosttranslational modification, protein turnover, chaperones [O] 0.99
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.99
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.99
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 0.99
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004009|Ga0055437_10256409All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300004025|Ga0055433_10181562All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005171|Ga0066677_10179272All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300005183|Ga0068993_10230973All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005332|Ga0066388_100137681All Organisms → cellular organisms → Bacteria2999Open in IMG/M
3300005332|Ga0066388_102063530All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300005444|Ga0070694_100005344All Organisms → cellular organisms → Bacteria7764Open in IMG/M
3300005445|Ga0070708_100969543All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium797Open in IMG/M
3300005518|Ga0070699_100412614All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300005537|Ga0070730_10168728All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1475Open in IMG/M
3300005549|Ga0070704_101994128All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005557|Ga0066704_10547268All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005713|Ga0066905_100550148All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300005764|Ga0066903_100666945All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300005829|Ga0074479_10650973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2176Open in IMG/M
3300005876|Ga0075300_1016619All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300005886|Ga0075286_1035528All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300009012|Ga0066710_100594537All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300009038|Ga0099829_10140418All Organisms → cellular organisms → Bacteria1920Open in IMG/M
3300009038|Ga0099829_10188536All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300009038|Ga0099829_10371593All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1179Open in IMG/M
3300009078|Ga0105106_10215829All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300009100|Ga0075418_11873356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales653Open in IMG/M
3300009100|Ga0075418_12886737All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300009137|Ga0066709_102930456All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300009156|Ga0111538_11339940All Organisms → cellular organisms → Bacteria → Proteobacteria903Open in IMG/M
3300009805|Ga0105079_1021012All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300010366|Ga0126379_10600250All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300010401|Ga0134121_11659314All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300011271|Ga0137393_10164343All Organisms → cellular organisms → Bacteria1861Open in IMG/M
3300011271|Ga0137393_11726813All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012096|Ga0137389_11752491All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300012171|Ga0137342_1071315All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300012174|Ga0137338_1121060All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300012189|Ga0137388_10201284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1795Open in IMG/M
3300012202|Ga0137363_10001277All Organisms → cellular organisms → Bacteria → Proteobacteria14399Open in IMG/M
3300012204|Ga0137374_10007946All Organisms → cellular organisms → Bacteria12593Open in IMG/M
3300012210|Ga0137378_10100472All Organisms → cellular organisms → Bacteria2655Open in IMG/M
3300012285|Ga0137370_10109356All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300012349|Ga0137387_10107096All Organisms → cellular organisms → Bacteria1955Open in IMG/M
3300012350|Ga0137372_10698561All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300012353|Ga0137367_10089508All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300012354|Ga0137366_10491454All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300012360|Ga0137375_11009285All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012363|Ga0137390_11646723All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012409|Ga0134045_1078548All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012922|Ga0137394_10007140All Organisms → cellular organisms → Bacteria8616Open in IMG/M
3300012930|Ga0137407_10226909All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300012964|Ga0153916_10013722All Organisms → cellular organisms → Bacteria → Proteobacteria6626Open in IMG/M
3300013306|Ga0163162_12815567All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300014882|Ga0180069_1164755All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300014883|Ga0180086_1133854All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300014884|Ga0180104_1128297All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300014885|Ga0180063_1025611All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300015264|Ga0137403_10005167All Organisms → cellular organisms → Bacteria15167Open in IMG/M
3300015371|Ga0132258_10012592All Organisms → cellular organisms → Bacteria → Proteobacteria17823Open in IMG/M
3300015371|Ga0132258_10247387All Organisms → cellular organisms → Bacteria → Proteobacteria4356Open in IMG/M
3300015371|Ga0132258_13236865All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300015372|Ga0132256_103499516All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300015373|Ga0132257_103424649All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300015374|Ga0132255_102835213All Organisms → cellular organisms → Bacteria → Proteobacteria741Open in IMG/M
3300017974|Ga0187777_10664726All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300017994|Ga0187822_10016324All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300018031|Ga0184634_10004969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4424Open in IMG/M
3300018063|Ga0184637_10590318All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300018082|Ga0184639_10164046All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300021081|Ga0210379_10264849All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300025318|Ga0209519_10450472All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300025535|Ga0207423_1039671All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300025535|Ga0207423_1041480All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300025569|Ga0210073_1002867All Organisms → cellular organisms → Bacteria → Proteobacteria3326Open in IMG/M
3300025580|Ga0210138_1003066All Organisms → cellular organisms → Bacteria → Proteobacteria3016Open in IMG/M
3300025922|Ga0207646_10201378All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1798Open in IMG/M
3300026015|Ga0208286_1010405All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300026023|Ga0207677_10553927All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300026469|Ga0257169_1033823All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300026480|Ga0257177_1003993All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300026507|Ga0257165_1030644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium937Open in IMG/M
3300026532|Ga0209160_1188276All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium836Open in IMG/M
3300027577|Ga0209874_1159952All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300027857|Ga0209166_10120808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1447Open in IMG/M
3300027862|Ga0209701_10016879All Organisms → cellular organisms → Bacteria4776Open in IMG/M
3300027875|Ga0209283_10143090All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300027909|Ga0209382_10697000All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300027979|Ga0209705_10180190All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300028803|Ga0307281_10276791All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria622Open in IMG/M
3300028872|Ga0307314_10304619All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300028878|Ga0307278_10170769All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300030006|Ga0299907_10078014All Organisms → cellular organisms → Bacteria2689Open in IMG/M
3300031548|Ga0307408_100078066All Organisms → cellular organisms → Bacteria2467Open in IMG/M
3300031740|Ga0307468_100079847All Organisms → cellular organisms → Bacteria1859Open in IMG/M
3300031903|Ga0307407_11165093All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031949|Ga0214473_10424889All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300032002|Ga0307416_100916860All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300032180|Ga0307471_100916990All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300032256|Ga0315271_11859351All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300032770|Ga0335085_10039996All Organisms → cellular organisms → Bacteria6445Open in IMG/M
3300032770|Ga0335085_11016448All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300032782|Ga0335082_10768530All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300032829|Ga0335070_10352764All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300034178|Ga0364934_0113526All Organisms → cellular organisms → Bacteria1021Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.78%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands6.93%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.97%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.98%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.99%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.99%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.99%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005876Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009805Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025569Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026015Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055437_1025640933300004009Natural And Restored WetlandsMVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTALLRS*
Ga0055433_1018156213300004025Natural And Restored WetlandsMVRSVSQIRGKLKWNFSANALFSAGVSKDTPMIAAFFLS*
Ga0066677_1017927213300005171SoilVPIVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPLAS*
Ga0068993_1023097323300005183Natural And Restored WetlandsMVRSVSQIRGKLKWNFSANALFSAGVSKDTPTIAAFFLS*
Ga0066388_10013768143300005332Tropical Forest SoilMVRSVSQISGKLKLNFSANFLLSAALSKEAPRMTAFLRS*
Ga0066388_10206353033300005332Tropical Forest SoilMERSVSLIRGKLKLNFSANFLLSAWLSKDAPRMTAFLASY*
Ga0070694_10000534443300005444Corn, Switchgrass And Miscanthus RhizosphereMARSVSQIRGKLKWNFSANARFSAGVSKETPRMTAFLRS*
Ga0070708_10096954313300005445Corn, Switchgrass And Miscanthus RhizosphereVPIVRSVSEISGKLKLNFSANFLLSAALSKDAPRMTAFLRS*
Ga0070699_10041261433300005518Corn, Switchgrass And Miscanthus RhizosphereVPIVRSVSQMSGKLKWYFSAKALFSAGVSNETPTIAAFFRS*
Ga0070730_1016872833300005537Surface SoilVSQRSGKLKWNFSANALFSWGVSKETPRMRAFFLS*
Ga0070704_10199412813300005549Corn, Switchgrass And Miscanthus RhizosphereMVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPFAS*
Ga0066704_1054726833300005557SoilVPIVRSVSQISGKLNWNFSANFLLSAALSKDAPRMTAFFRS*
Ga0066905_10055014833300005713Tropical Forest SoilVSQISGKVKWNFSANFLLSSGVSNETPRMTAFFRS*
Ga0066903_10066694513300005764Tropical Forest SoilVPIVRSVSQINGKLKENFSANFLLSAGESKEMPRIAAFFRS*
Ga0074479_1065097333300005829Sediment (Intertidal)MVRSVSQISGKLKLNFSANFLLSATLSKDAPRMTAFLWS*
Ga0075300_101661933300005876Rice Paddy SoilVSQIRGKLKWNFSANARFSAGVSKETPRMTAFLRS*
Ga0075286_103552833300005886Rice Paddy SoilMTRSVSQMSGKLKWNFSANARFSAGVSKETPRMTAFLRS*
Ga0066710_10059453733300009012Grasslands SoilVPIVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPLAS
Ga0099829_1014041823300009038Vadose Zone SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS*
Ga0099829_1018853623300009038Vadose Zone SoilVPILRSVSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS*
Ga0099829_1037159333300009038Vadose Zone SoilVPILRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS*
Ga0105106_1021582923300009078Freshwater SedimentLAGSALAPYAVPIVRSVSQRRGKLKLNFSAKALFAAALSNDAPRMTAPFAS*
Ga0075418_1187335623300009100Populus RhizosphereMARSVSQMSGKLKWCFSAKALFSAGASKEAPRIAAFFRS*
Ga0075418_1288673713300009100Populus RhizosphereLAPYAVPIFRSVSQISGKLKPNFSANALLAAALSNEAPRMTAFLAS*
Ga0066709_10293045633300009137Grasslands SoilVPIVRSVSQISGKLKLNFSAKALLAAGLSNDAPRMTAPLAS*
Ga0111538_1133994033300009156Populus RhizosphereSVSQMSGKLKWYFSAKALFSAGVSKETPRIAAFFRS*
Ga0105079_102101223300009805Groundwater SandVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLPS*
Ga0126379_1060025013300010366Tropical Forest SoilRSVSQISGKVKWNFSANFLLSSGVSNETPRMTAFFRS*
Ga0134121_1165931433300010401Terrestrial SoilVSHSSGKLKLNFSANFLLSASLSKDAPTIAAFFRS*
Ga0137393_1016434343300011271Vadose Zone SoilVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS*
Ga0137393_1172681333300011271Vadose Zone SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS*
Ga0137389_1175249133300012096Vadose Zone SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS*
Ga0137342_107131533300012171SoilVPIVRSVSQISGKVKLNFSANFLLSASLSNETPRMTAFFRS*
Ga0137338_112106023300012174SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTQFLRS*
Ga0137388_1020128423300012189Vadose Zone SoilVSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS*
Ga0137363_1000127753300012202Vadose Zone SoilVSQISGKLKLNFSANFLLSAALSKDAPRITAFLRS*
Ga0137374_10007946113300012204Vadose Zone SoilVPILRSVSEISGKLKLNFSANFLLSAALSKDAPRMTAFFRS*
Ga0137378_1010047263300012210Vadose Zone SoilSVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFFRS*
Ga0137370_1010935633300012285Vadose Zone SoilVPIFRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPLAS*
Ga0137387_1010709623300012349Vadose Zone SoilVPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFFRS*
Ga0137372_1069856113300012350Vadose Zone SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRL*
Ga0137367_1008950843300012353Vadose Zone SoilVSEISGKLKLNFSANFLLSAALSKDAPRMTAFFRS*
Ga0137366_1049145433300012354Vadose Zone SoilVPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPIMTAFFRS*
Ga0137375_1100928513300012360Vadose Zone SoilRSVSQRSGKLKPYLSANALLSAGVSKEMPRMTASFLS*
Ga0137390_1164672333300012363Vadose Zone SoilVPIVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPFAS*
Ga0134045_107854823300012409Grasslands SoilVPIVRSVSQISGKLKLNFPAKALLAAGLSNDAPRMTAPLAS*
Ga0137394_1000714033300012922Vadose Zone SoilVPIVRSVSQISGKLKWNFSAKLLFSAGVSKDTPRITAPFRS*
Ga0137407_1022690933300012930Vadose Zone SoilVPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFFRP*
Ga0153916_1001372233300012964Freshwater WetlandsVPIIRSVSQISGKLKLNFSANFLLSSALSKDAPRMTAFLRS*
Ga0163162_1281556723300013306Switchgrass RhizosphereVPIFRSVSQMSGKLKLNFSANFLLSASLSKDAPTIAAFFRS*
Ga0180069_116475533300014882SoilVPIVRSVSQISGKLKLNFSANFLLSASLSNEAPRMTAFFRS*
Ga0180086_113385423300014883SoilLAPYAVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS*
Ga0180104_112829723300014884SoilVPIVRSVSQISGKLKENFSAKALFSAGVSKDAPRMTAFLRS*
Ga0180063_102561113300014885SoilVSQRSGKGKLNFSANFLLSASLSNETPRMTAFFRS*
Ga0137403_1000516773300015264Vadose Zone SoilVPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFLRS*
Ga0132258_1001259263300015371Arabidopsis RhizosphereVPISRSVSQMSGKLKWYFSAKALFSAGVSKETPRIAAFFRS*
Ga0132258_1024738763300015371Arabidopsis RhizosphereVPIFRSVSQISGKLKWYFSANALFSAGVSNETPTIAALFRS*
Ga0132258_1323686533300015371Arabidopsis RhizosphereVPIFRSVSQISGKLKWNFSAKALFSAGVSNETPTIAAFFRS*
Ga0132256_10349951633300015372Arabidopsis RhizosphereMLRSVSQISGKLEWNFSANALFSAGVSNDMPTIAAFFRS*
Ga0132257_10342464933300015373Arabidopsis RhizosphereSVSQSSGKLNPYLSANALLSAGGSKETPMMAAPFLS*
Ga0132255_10283521313300015374Arabidopsis RhizosphereIFRSVSQISGKLKWYFSPNALFSAGVSKETPTIAALFRS*
Ga0187777_1066472613300017974Tropical PeatlandVPIARSVSQISGKLKWNFSAKALFSAGVSNDAPRMTAFLASY
Ga0187822_1001632433300017994Freshwater SedimentMARSVSQISGKLKWNFSANARFSAGVSKETPRIAAFLRS
Ga0184634_1000496933300018031Groundwater SedimentVPIFRSVSQISGKLKLYLSANALFSAGVSKETPRMTAPFVS
Ga0184637_1059031823300018063Groundwater SedimentVPIFRSVSQISGKLKLNLSAKALFSAGVSKETPRTTAPFAT
Ga0184639_1016404633300018082Groundwater SedimentVSQISGKLKLNLSAKALFSAGVSKETTRTTAQFAT
Ga0210379_1026484923300021081Groundwater SedimentVPIFRSVSQISGKLKLNLSANALFSAGVSKETPRTTAPFAS
Ga0209519_1045047233300025318SoilLAPYAVPIVRSVSQIRGKLKLNFSANFLLSVALSNEAPRMTAFFRS
Ga0207423_103967123300025535Natural And Restored WetlandsMSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS
Ga0207423_104148033300025535Natural And Restored WetlandsMVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTALLRS
Ga0210073_100286743300025569Natural And Restored WetlandsMSQISGKLKLNFSANFLLSAALSKDAPRMTALLRS
Ga0210138_100306673300025580Natural And Restored WetlandsMVRSVSQISGKLKLNFSANFLLSAALSKDAPRLTALLRS
Ga0207646_1020137823300025922Corn, Switchgrass And Miscanthus RhizosphereVPIVRSVSEISGKLKLNFSANFLLSAALSKDAPRMTAFLRS
Ga0208286_101040533300026015Rice Paddy SoilMARSVSQIRGKLKWNFSANARFSAGVSKETPRMTAFLRS
Ga0207677_1055392733300026023Miscanthus RhizosphereVSHNRGKLKLNFSAKALFFSGLSKLTPRMTAFFSVY
Ga0257169_103382333300026469SoilVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS
Ga0257177_100399323300026480SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS
Ga0257165_103064433300026507SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS
Ga0209160_118827633300026532SoilVPIVRSVSQISGKLNWNFSANFLLSAALSKDAPRMTAFFRS
Ga0209874_115995223300027577Groundwater SandVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLPS
Ga0209166_1012080833300027857Surface SoilVSQRSGKLKWNFSANALFSWGVSKETPRMRAFFLS
Ga0209701_1001687973300027862Vadose Zone SoilVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS
Ga0209283_1014309043300027875Vadose Zone SoilVSQISGKLNLNFSANFLLSAALSKDAPRMTAFFRS
Ga0209382_1069700013300027909Populus RhizosphereAVPIFRSVSQINGKLKPNFSANALFAAGLSNDAPRMTAFLAS
Ga0209705_1018019033300027979Freshwater SedimentLAGSALAPYAVPIVRSVSQRRGKLKLNFSAKALFAAALSNDAPRMTAPFAS
Ga0307281_1027679123300028803SoilVPIVRSVSQISGKLKLNLSANALFSAGVSKETPRMTAPFAS
Ga0307314_1030461913300028872SoilVVSQRSGKLKPYFSENFLFAAGVSKLTPKISAPLSL
Ga0307278_1017076933300028878SoilVSQISGKLKLYLSVNALFSAGVSKETPRMTAPFLS
Ga0299907_1007801433300030006SoilMVRSVSQISGKLNWNFSANFLLSAALSKEAPRMTAFLASY
Ga0307408_10007806633300031548RhizosphereVPIVRSVSQMSGKLKWNFSAKALFSAGLSKDAPRMTAFLRS
Ga0307468_10007984733300031740Hardwood Forest SoilMVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS
Ga0307407_1116509323300031903RhizosphereVSERSGKVKLNFSANFLLSAALSKDAPRMTAFLRS
Ga0214473_1042488933300031949SoilVPIFRSVSQISGKSKLNFSANALFSAGVSKETPTTAAPFWS
Ga0307416_10091686033300032002RhizosphereVPIVRSVSQMSGKLKLNFSAKALFSAGLSKDAPRMTAFLRS
Ga0307471_10091699033300032180Hardwood Forest SoilLRSVSQISGKLKWNFSANFLLSSGVSNETPRMTAFFRS
Ga0315271_1185935123300032256SedimentVPIVRSVSQSSGKLKPYLSANALLSAGVSKETPRMTASFLS
Ga0335085_1003999613300032770SoilVSQISGKLNLNFSANFLLSATLSKDAPRMTAFLRS
Ga0335085_1101644823300032770SoilVSQIKGKLKENFSANFLLSAGVSKEIPRIAAFFRS
Ga0335082_1076853013300032782SoilVRSVSQRSGKLKWNFSANFLFSAGVSNDTPRITAFFLS
Ga0335070_1035276433300032829SoilMVRSVSQISGKLKLNFSANFLLSAAPSKDAPRMTAFLRS
Ga0364934_0113526_592_6993300034178SedimentVSQISGKLKLNLAANALFSAGVSKETPRTMAPFAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.