NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F102152

Metagenome Family F102152

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102152
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 47 residues
Representative Sequence AEELGDRQLPAWTWRNLAKVAELRGDKAAAEELLRRSQDAESRGPH
Number of Associated Samples 92
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.529 % of family members)
Environment Ontology (ENVO) Unclassified
(38.235 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.922 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.89%    β-sheet: 0.00%    Coil/Unstructured: 58.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF04264YceI 20.59
PF00583Acetyltransf_1 9.80
PF02518HATPase_c 9.80
PF08281Sigma70_r4_2 8.82
PF13489Methyltransf_23 2.94
PF00027cNMP_binding 1.96
PF04237YjbR 1.96
PF07690MFS_1 1.96
PF01209Ubie_methyltran 1.96
PF12680SnoaL_2 1.96
PF00775Dioxygenase_C 1.96
PF00106adh_short 1.96
PF12698ABC2_membrane_3 0.98
PF10604Polyketide_cyc2 0.98
PF04185Phosphoesterase 0.98
PF00202Aminotran_3 0.98
PF02687FtsX 0.98
PF00437T2SSE 0.98
PF02896PEP-utilizers_C 0.98
PF01022HTH_5 0.98
PF00990GGDEF 0.98
PF07905PucR 0.98
PF02566OsmC 0.98
PF05050Methyltransf_21 0.98
PF12832MFS_1_like 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 20.59
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 1.96
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 1.96
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 1.96
COG2508DNA-binding transcriptional regulator, PucR/PutR familyTranscription [K] 1.96
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 1.96
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.98
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.98
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E02GZWYJAll Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14357906All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300001154|JGI12636J13339_1003160All Organisms → cellular organisms → Bacteria2741Open in IMG/M
3300001361|A30PFW6_1080845All Organisms → cellular organisms → Bacteria1616Open in IMG/M
3300001593|JGI12635J15846_10003167All Organisms → cellular organisms → Bacteria14358Open in IMG/M
3300002912|JGI25386J43895_10052182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1170Open in IMG/M
3300002916|JGI25389J43894_1056980All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005167|Ga0066672_10604755All Organisms → cellular organisms → Bacteria → Terrabacteria group710Open in IMG/M
3300005175|Ga0066673_10168360All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300005181|Ga0066678_10284809All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300005184|Ga0066671_10162794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1312Open in IMG/M
3300005187|Ga0066675_10396990All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300005332|Ga0066388_100393781All Organisms → cellular organisms → Bacteria2031Open in IMG/M
3300005444|Ga0070694_100977357All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005445|Ga0070708_100779584All Organisms → cellular organisms → Bacteria → Proteobacteria899Open in IMG/M
3300005450|Ga0066682_10165043All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300005454|Ga0066687_10580105All Organisms → cellular organisms → Bacteria → Terrabacteria group666Open in IMG/M
3300005467|Ga0070706_100708397All Organisms → cellular organisms → Bacteria → Proteobacteria933Open in IMG/M
3300005518|Ga0070699_100971771All Organisms → cellular organisms → Bacteria → Terrabacteria group778Open in IMG/M
3300005518|Ga0070699_101959785All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005535|Ga0070684_101303264All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005540|Ga0066697_10344521All Organisms → cellular organisms → Bacteria → Terrabacteria group869Open in IMG/M
3300005545|Ga0070695_101662392All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300005552|Ga0066701_10931354All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005553|Ga0066695_10558560All Organisms → cellular organisms → Bacteria → Terrabacteria group694Open in IMG/M
3300005558|Ga0066698_10286896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1140Open in IMG/M
3300005559|Ga0066700_11134417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300005566|Ga0066693_10102968All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300005568|Ga0066703_10132967All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300005586|Ga0066691_10736757All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005598|Ga0066706_10665819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium826Open in IMG/M
3300005764|Ga0066903_102720232All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300005981|Ga0081538_10066480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2021Open in IMG/M
3300006804|Ga0079221_10327594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia913Open in IMG/M
3300006804|Ga0079221_10815596All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300006852|Ga0075433_10727882All Organisms → cellular organisms → Bacteria → Terrabacteria group868Open in IMG/M
3300006852|Ga0075433_11763115All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300006854|Ga0075425_102297091All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300006893|Ga0073928_10465166All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300006893|Ga0073928_10892165All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300006903|Ga0075426_10989818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium635Open in IMG/M
3300007076|Ga0075435_101666924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300007265|Ga0099794_10352273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium766Open in IMG/M
3300007788|Ga0099795_10629123All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009012|Ga0066710_103384346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium606Open in IMG/M
3300009088|Ga0099830_10917529All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300009089|Ga0099828_11590476All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300009090|Ga0099827_10234143All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300009137|Ga0066709_103899318All Organisms → cellular organisms → Bacteria → Terrabacteria group542Open in IMG/M
3300009137|Ga0066709_104429972All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300009143|Ga0099792_10931329All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010047|Ga0126382_12507068All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300010323|Ga0134086_10336256All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300010326|Ga0134065_10093036All Organisms → cellular organisms → Bacteria → Terrabacteria group991Open in IMG/M
3300010326|Ga0134065_10334491All Organisms → cellular organisms → Bacteria → Terrabacteria group590Open in IMG/M
3300010335|Ga0134063_10216879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium904Open in IMG/M
3300010336|Ga0134071_10223753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium932Open in IMG/M
3300010399|Ga0134127_10150846All Organisms → cellular organisms → Bacteria2110Open in IMG/M
3300011269|Ga0137392_10308069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1309Open in IMG/M
3300011270|Ga0137391_10055724All Organisms → cellular organisms → Bacteria3375Open in IMG/M
3300011270|Ga0137391_11146044All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300011271|Ga0137393_11270476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300011271|Ga0137393_11482346All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012189|Ga0137388_11295808All Organisms → cellular organisms → Bacteria → Terrabacteria group667Open in IMG/M
3300012201|Ga0137365_10135238All Organisms → cellular organisms → Bacteria → Terrabacteria group1853Open in IMG/M
3300012202|Ga0137363_10598645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium930Open in IMG/M
3300012203|Ga0137399_10791244All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300012204|Ga0137374_10362678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter → Ilumatobacter sp.1164Open in IMG/M
3300012208|Ga0137376_10916649All Organisms → cellular organisms → Bacteria → Terrabacteria group752Open in IMG/M
3300012210|Ga0137378_10979041All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012211|Ga0137377_11612091All Organisms → cellular organisms → Bacteria → Terrabacteria group573Open in IMG/M
3300012350|Ga0137372_11183660All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300012917|Ga0137395_11052595All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300012972|Ga0134077_10310250All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300014157|Ga0134078_10580109All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300015359|Ga0134085_10102209All Organisms → cellular organisms → Bacteria → Terrabacteria group1190Open in IMG/M
3300018433|Ga0066667_12326091All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300018468|Ga0066662_10732818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium949Open in IMG/M
3300019888|Ga0193751_1150278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium836Open in IMG/M
3300020581|Ga0210399_10546694All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300025910|Ga0207684_10197831All Organisms → cellular organisms → Bacteria1734Open in IMG/M
3300026301|Ga0209238_1070672All Organisms → cellular organisms → Bacteria → Terrabacteria group1227Open in IMG/M
3300026306|Ga0209468_1205774All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300026316|Ga0209155_1038021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1920Open in IMG/M
3300026323|Ga0209472_1038844All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300026323|Ga0209472_1269988All Organisms → cellular organisms → Bacteria → Terrabacteria group542Open in IMG/M
3300026329|Ga0209375_1220751All Organisms → cellular organisms → Bacteria → Terrabacteria group681Open in IMG/M
3300026334|Ga0209377_1129531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium997Open in IMG/M
3300026537|Ga0209157_1254873All Organisms → cellular organisms → Bacteria → Terrabacteria group684Open in IMG/M
3300026548|Ga0209161_10102518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1723Open in IMG/M
3300026555|Ga0179593_1079719All Organisms → cellular organisms → Bacteria2824Open in IMG/M
3300027842|Ga0209580_10006628All Organisms → cellular organisms → Bacteria4951Open in IMG/M
3300027842|Ga0209580_10110603All Organisms → cellular organisms → Bacteria → Terrabacteria group1334Open in IMG/M
3300027857|Ga0209166_10717409All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300027882|Ga0209590_10002661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7212Open in IMG/M
3300027894|Ga0209068_10303765All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300028536|Ga0137415_10666349All Organisms → cellular organisms → Bacteria → Proteobacteria853Open in IMG/M
3300031736|Ga0318501_10373767All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300031792|Ga0318529_10488768All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031965|Ga0326597_10948382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium875Open in IMG/M
3300032063|Ga0318504_10665098All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300032205|Ga0307472_101153913All Organisms → cellular organisms → Bacteria737Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil22.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.94%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_018685902189573000Grass SoilAEELGDRQIPPWTWRHLAVVAELRGDNATAAEWLKRAKDAQSRGPR*RSGLQEDQRD
ICChiseqgaiiFebDRAFT_1435790633300000363SoilSWTWRALAKVSERRGNQAEAEQRIRQSHEAEAQRPR*
JGI12636J13339_100316013300001154Forest SoilELGDRQLPGWTWRALAKVAELRGDASAAEAHWRRSKEAESRGPH*
A30PFW6_108084543300001361PermafrostAEEDLRHAIRIAEELGDRQLPGWTWRALAKVAELRGDGAEAEEHWRRSREAESRGPH*
JGI12635J15846_1000316713300001593Forest SoilIRIAEELGDRQLPGWTWRALAKVAELRGDASAAEAHWRRSKEAESRGPH*
JGI25386J43895_1005218213300002912Grasslands SoilEEMGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH*
JGI25389J43894_105698023300002916Grasslands SoilIRTAEELGDRQLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH*
Ga0066672_1060475513300005167SoilRFAIRVAEELGDRQLPAWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH*
Ga0066673_1016836013300005175SoilDLRFAIRIAEELGDRQIPGWTWRALAQVSELRGDQAEADERMRRSREAQARGPR*
Ga0066678_1028480923300005181SoilEEDLRFAIRTAEELGDRQLPAWTWRNLAKVAELRGDKAAAEELLQRSRDAELRGPH*
Ga0066671_1016279413300005184SoilRVAEELGDRQLPGWTWRALARVSELRGDQAAAEERHRRSREALIRGPR*
Ga0066675_1039699023300005187SoilAEEDLRFAIRIAEELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIVRGPR*
Ga0066388_10039378113300005332Tropical Forest SoilAAIRIAEEMGDRQLPPWTWRNLAQVAELRGDKAAAEELLKRSKDAESRGPH*
Ga0070694_10097735713300005444Corn, Switchgrass And Miscanthus RhizosphereAIRTAEELGDRQIPPWTWRNLAVVAELRGDNATAAEWLKRAKDAESRGPR*
Ga0070708_10077958413300005445Corn, Switchgrass And Miscanthus RhizosphereRIAEELGDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH*
Ga0066682_1016504313300005450SoilAEEDLRFAIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH*
Ga0066687_1058010513300005454SoilELGDRQLPGWTWRALARVSELRGDQAAAEERHRRSREALIRGPR*
Ga0070706_10070839723300005467Corn, Switchgrass And Miscanthus RhizosphereGDRQLPGWTWRALARVAELRGDRAEAEERWRRSREAESRGPH*
Ga0070699_10097177123300005518Corn, Switchgrass And Miscanthus RhizosphereGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIIRGPR*
Ga0070699_10195978523300005518Corn, Switchgrass And Miscanthus RhizosphereIRTAEELGDRQLPPWTWRHLAIVAELRGDNATAAEWLKRAKDAESRGPR*
Ga0070684_10130326423300005535Corn RhizosphereRQLASWMWRALAQVSERRGDTAEAEQRLRRSREAEAKGPK*
Ga0066697_1034452113300005540SoilIRTAEEMGDRQLPPWTWRNLAKVAELRGDKAAAEELLKRSRDAESRGPH*
Ga0070695_10166239223300005545Corn, Switchgrass And Miscanthus RhizosphereTAEELGDRQLPPWTWRHLAVVAELRGDNATAAEWLKRAKDAESRGPR*
Ga0066701_1093135423300005552SoilGDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH*
Ga0066695_1055856013300005553SoilRAAIRIAEELGDKQLPPWTWRNLARVAELRGDKAAAEELLQRSKDAESRGPH*
Ga0066698_1028689613300005558SoilEDLRAAIRIAEELGDRQLPPWTLRNLATVAELRGDKVAAEELLKRSKDAESRGPH*
Ga0066700_1113441713300005559SoilAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH*
Ga0066693_1010296813300005566SoilAIRVAEELGDRQLPAWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH*
Ga0066703_1013296713300005568SoilDLKHAIRIAEELGDRQLPGWTWRALAKVSELRGDRAEAEERWRKSREAESRGPH*
Ga0066691_1073675713300005586SoilLGDRQLPAWTWRNLAKVAELRGDKAAAEELLQRSRDAELRGPH*
Ga0066706_1066581913300005598SoilFAIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH*
Ga0066903_10272023213300005764Tropical Forest SoilFAVRAAEELGDRQLPVWTWRALARVSELRGDTAEAAERLERSHEAESVGPH*
Ga0081538_1006648013300005981Tabebuia Heterophylla RhizosphereERQMGEWTWRAFALVAEKRGDQAEAERRWRRSREAQAQGPK*
Ga0079221_1032759423300006804Agricultural SoilWTWRNLARVAELRGDAAAAQELLARSKDAELRGPH*
Ga0079221_1081559623300006804Agricultural SoilWTWRALARVSELRGDQAEADERHRRSREALIRGPH*
Ga0075433_1072788223300006852Populus RhizosphereGDRQIPPWTWRNLAVVAELRGDNATAAEWLKRAKDAESRGPR*
Ga0075433_1176311513300006852Populus RhizosphereRIAEELGDRQLPPWTLRNLAKVAELRGDKVAAEELLRQSKDAESRGPH*
Ga0075425_10229709123300006854Populus RhizospherePPWTLRNLAKVAELRGDKVAAEELLRQSKDAESRGPH*
Ga0073928_1046516633300006893Iron-Sulfur Acid SpringAIRIAEELGDRQLPGWTWRALAQVAELRGDGAAAEEHWRRSREAQSRGPH*
Ga0073928_1089216513300006893Iron-Sulfur Acid SpringDRQLPGWTWRALARVAELRGDGAAAEEHWRRSREAESRGPH*
Ga0075426_1098981813300006903Populus RhizosphereRQLPPWTLRNLAKVAELRGDKVAAEELLRQSKHAESRGPH*
Ga0075435_10166692423300007076Populus RhizosphereTLRNLAKVAELRGDKVAAEELLRQSKHAESRGPH*
Ga0099794_1035227313300007265Vadose Zone SoilEDLRFAIRIAEELGDRQLPGWTWRALAKVAELRGDKAEAEERWRRSREAQSRGPH*
Ga0099795_1062912323300007788Vadose Zone SoilRYAIRIAEELGDRQLPGWTWRALAKVAELRGDKETAEEHWRRSREAESRGPH*
Ga0066710_10338434623300009012Grasslands SoilFAIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH
Ga0099830_1091752913300009088Vadose Zone SoilRYAIRVAEELGDRQLPGWTWRALARVAELRGDTSEAEERWRRSREAESRGPH*
Ga0099828_1159047623300009089Vadose Zone SoilLGDRQLPGWTWRALARVAELRGDKTEADERWRRSREAESRGPR*
Ga0099827_1023414333300009090Vadose Zone SoilWTWRALARVAELRGDKTEAEERWRRSREAESRGPR*
Ga0066709_10389931823300009137Grasslands SoilEELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIVRGPR*
Ga0066709_10442997223300009137Grasslands SoilELGDRQLPAWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH*
Ga0099792_1093132923300009143Vadose Zone SoilYAIRIAEELGDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH*
Ga0126382_1250706813300010047Tropical Forest SoilRQLPGWTWRALARVSELRGNQAEAEERHRRSREALIRGPH*
Ga0134086_1033625623300010323Grasslands SoilAEEDLRAAIRIAEELGDRQLPPWTLRNLAKVAELRGDKVAAEELLKRSKDAESRGPQ*
Ga0134065_1009303613300010326Grasslands SoilAWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH*
Ga0134065_1033449113300010326Grasslands SoilGRLDQAEEELRFAIRTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR*
Ga0134063_1021687923300010335Grasslands SoilIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH*
Ga0134071_1022375323300010336Grasslands SoilGDRQLPAWTWRHLAKVAELRGDKAAAEELLQRSKDAESRGPH*
Ga0134127_1015084643300010399Terrestrial SoilPSWTWRALAKVSELRGDQAEAEERYRRSKEAESRGPH*
Ga0137392_1030806913300011269Vadose Zone SoilLGDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH*
Ga0137391_1005572413300011270Vadose Zone SoilIRVAEELGDRQLPGWTWRALARVAELRGDTSEAEERWRRSREAESRGPH*
Ga0137391_1114604413300011270Vadose Zone SoilGDRQLPGWTWRALAKVAELRGDTAEAEERWRRSKEAESRGPH*
Ga0137393_1127047623300011271Vadose Zone SoilAIRIAEELGDRQLPGWTWRALAKVAELRGDGAAAEEHWRRSREAESRGPH*
Ga0137393_1148234623300011271Vadose Zone SoilRQLPGWTWRALARVAELRGDKTEAEERWRRSREAESRGPR*
Ga0137388_1129580823300012189Vadose Zone SoilFAIRIAEELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIIRGPR*
Ga0137365_1013523813300012201Vadose Zone SoilAEEDLRFAIRTAEELGDRQLPPWTWRNLAKVAELRGDKAAAEELLKRSRDAESRGPH*
Ga0137363_1059864513300012202Vadose Zone SoilTWRALALVAERRGDKAEAEERWRRSREAESRGPH*
Ga0137399_1079124423300012203Vadose Zone SoilIRIAEELGDRQLPGWTWRALAKVAELRGDKETAEEHWRRSREAESRGPH*
Ga0137374_1036267823300012204Vadose Zone SoilLASWTWRALAEVSERRGDKAEAEQRLRRSREAEAQGPR*
Ga0137376_1091664923300012208Vadose Zone SoilLRFAIRTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR*
Ga0137378_1097904123300012210Vadose Zone SoilAWTWRNLAKVAELRGDKAGAEELLQRSRDAELRGPH*
Ga0137377_1161209123300012211Vadose Zone SoilRFAIRTAEELGDRQLPPWTWRHLAKVAELRGDKAAAEELLKRSRDAESRGPH*
Ga0137372_1118366023300012350Vadose Zone SoilRYALKISDELGDRQLPGWTWRALARVSERRGDQAEAEERFRRSREAELRGPH*
Ga0137395_1105259523300012917Vadose Zone SoilPGWTWRALARVAELRGDKTEAEERWRRSREAESRGPR*
Ga0134077_1031025023300012972Grasslands SoilQLPPWTLRNLAKVAELRGDEVAAEELLRQSKDAESRGPH*
Ga0134078_1058010923300014157Grasslands SoilLDQAEEDLRFAIRTAEELGDRQLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH
Ga0134085_1010220933300015359Grasslands SoilELGDRQLPPWTLRNLAKVAELRGDKVAAEELLKRSKDAESRGPH*
Ga0066667_1232609113300018433Grasslands SoilRTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR
Ga0066662_1073281823300018468Grasslands SoilEEDLRFAIRVAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH
Ga0193751_115027833300019888SoilIRIAEELGDRQLPGWTWRALAMVAELRGDEAAAEEHWRRSKDAESRGPH
Ga0210399_1054669423300020581SoilDRQLPGWVWRALARVAELRGDKTEAEERLRRSREAESRGPR
Ga0207684_1019783143300025910Corn, Switchgrass And Miscanthus RhizosphereEEDLQFAVRVAEELGDRQLPVWTWRALARVSELRGDSAQAEERRRRSHQAESVGPH
Ga0209238_107067213300026301Grasslands SoilEDLRFAIRTAEELGDRQLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH
Ga0209468_120577423300026306SoilQLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH
Ga0209155_103802113300026316SoilLRFAIRTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR
Ga0209472_103884413300026323SoilAEELGDRQLPAWTWRNLAKVAELRGDKAAAEELLRRSQDAESRGPH
Ga0209472_126998823300026323SoilEMGDRQLPPWTWRNLAKVAELRGDKAAAEELLKRSRDAESRGPH
Ga0209375_122075113300026329SoilWTWRNLAKVAELRGDKAAAEELLQRSLDAESRGPH
Ga0209377_112953113300026334SoilAIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH
Ga0209157_125487313300026537SoilDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIVRGPR
Ga0209161_1010251833300026548SoilPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH
Ga0179593_107971973300026555Vadose Zone SoilDDGTWRALAKVSEQRGDQAEADERMRRSREAQARGPR
Ga0209580_1000662813300027842Surface SoilLPGWTWRNLARVAELRGDKAEAEELMRRSREAESRGPH
Ga0209580_1011060313300027842Surface SoilLPGWTLRHLARVMELRGDKAEAEELLRRSHQAESQSPR
Ga0209166_1071740923300027857Surface SoilEELGDRQLPGWTWRALARVSELRGDQAEADERMRRSREAQARGPR
Ga0209590_1000266193300027882Vadose Zone SoilEDLRFAIRIAEELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIIRGPR
Ga0209068_1030376513300027894WatershedsAEDLGDRQLPGWTWRALARVAELRGDSPEAEERWRRSLEAESRGPH
Ga0137415_1066634913300028536Vadose Zone SoilAEELGDRQLPGWTWRALAKVAELRGDKETAEEHWRRSREAESRGPH
Ga0318501_1037376713300031736SoilAIRIAEELGDRQLPAWTWRNLARVAELRGDAAAAEELLARSKDAELRGPH
Ga0318529_1048876813300031792SoilPVAGELGDRQLPSWTWRALARISELRGDVAQAEERTRRSEEAESVGPH
Ga0326597_1094838223300031965SoilERQLASWTWRALAKVSERRGDTAEAERRLRRSREAEAQGPR
Ga0318504_1066509823300032063SoilRIAEELGDRQLPAWTWRNLARVAELRGDAAAAEELLARSKDAELRGPH
Ga0307472_10115391313300032205Hardwood Forest SoilDRQLPVWTWRALARVSELRGDTAGADERRQRSQQAESIGPH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.