NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F102096

Metagenome Family F102096

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102096
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence ARLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA
Number of Associated Samples 89
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 93.14 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.137 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(7.843 % of family members)
Environment Ontology (ENVO) Unclassified
(38.235 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.235 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.22%    β-sheet: 0.00%    Coil/Unstructured: 52.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13472Lipase_GDSL_2 12.75
PF01425Amidase 7.84
PF0563523S_rRNA_IVP 6.86
PF09594GT87 2.94
PF01070FMN_dh 2.94
PF04434SWIM 1.96
PF04909Amidohydro_2 1.96
PF00408PGM_PMM_IV 1.96
PF03807F420_oxidored 0.98
PF11846Wzy_C_2 0.98
PF01797Y1_Tnp 0.98
PF13343SBP_bac_6 0.98
PF03972MmgE_PrpD 0.98
PF04519Bactofilin 0.98
PF13654AAA_32 0.98
PF02880PGM_PMM_III 0.98
PF00535Glycos_transf_2 0.98
PF09084NMT1 0.98
PF13379NMT1_2 0.98
PF14606Lipase_GDSL_3 0.98
PF13458Peripla_BP_6 0.98
PF00106adh_short 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 7.84
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 2.94
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 2.94
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 2.94
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 2.94
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 1.96
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 1.96
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 1.96
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.98
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 0.98
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.98
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.98
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.14 %
UnclassifiedrootN/A6.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1063876All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300001431|F14TB_103507247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium938Open in IMG/M
3300004013|Ga0055465_10234610All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005294|Ga0065705_10157557All Organisms → cellular organisms → Bacteria1837Open in IMG/M
3300005295|Ga0065707_10550746All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005295|Ga0065707_10584520All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005295|Ga0065707_10695139All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005339|Ga0070660_100427286All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300005558|Ga0066698_10307449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1098Open in IMG/M
3300005713|Ga0066905_101227573All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005713|Ga0066905_102188714All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005764|Ga0066903_104550121All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005764|Ga0066903_109090880All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005873|Ga0075287_1045970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ai1a-2592Open in IMG/M
3300006046|Ga0066652_101569420All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300006845|Ga0075421_101902920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300006876|Ga0079217_10105013All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300006918|Ga0079216_10246946All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300006969|Ga0075419_10080386All Organisms → cellular organisms → Bacteria2075Open in IMG/M
3300007004|Ga0079218_10499459All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300007076|Ga0075435_100262881All Organisms → cellular organisms → Bacteria → Proteobacteria1470Open in IMG/M
3300009094|Ga0111539_10333587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1765Open in IMG/M
3300009094|Ga0111539_10655528All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300009157|Ga0105092_10031241All Organisms → cellular organisms → Bacteria → Proteobacteria2824Open in IMG/M
3300009157|Ga0105092_10867028Not Available532Open in IMG/M
3300009167|Ga0113563_10415393All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300009810|Ga0105088_1021080Not Available1020Open in IMG/M
3300009837|Ga0105058_1191324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300010043|Ga0126380_11658512All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300010362|Ga0126377_11527084All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300010401|Ga0134121_10413995All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300011432|Ga0137428_1110148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium788Open in IMG/M
3300012038|Ga0137431_1023892All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300012203|Ga0137399_11688589All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300012355|Ga0137369_10169332All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300012357|Ga0137384_10646599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium861Open in IMG/M
3300012360|Ga0137375_11059362Not Available633Open in IMG/M
3300012501|Ga0157351_1036981All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012517|Ga0157354_1003217All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300012519|Ga0157352_1010030All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300012582|Ga0137358_10323696All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300012893|Ga0157284_10332085All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012924|Ga0137413_11044801All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300012929|Ga0137404_12127307All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300012951|Ga0164300_10016667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2457Open in IMG/M
3300012976|Ga0134076_10114858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1079Open in IMG/M
3300013308|Ga0157375_12227925All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300013308|Ga0157375_13117401All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300014267|Ga0075313_1101687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300015242|Ga0137412_10924889All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300015373|Ga0132257_102049558All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300015373|Ga0132257_103340623All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300015373|Ga0132257_104620494All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300016404|Ga0182037_10164755All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300017654|Ga0134069_1111774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium895Open in IMG/M
3300017792|Ga0163161_11216327All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales652Open in IMG/M
3300018000|Ga0184604_10024073All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300018052|Ga0184638_1051733All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1495Open in IMG/M
3300018056|Ga0184623_10239034All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300018063|Ga0184637_10235505All Organisms → cellular organisms → Bacteria → Proteobacteria1118Open in IMG/M
3300018482|Ga0066669_11325608All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300022756|Ga0222622_10101082All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300025289|Ga0209002_10305598All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300025322|Ga0209641_10923468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300025326|Ga0209342_10304395All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300025555|Ga0210121_1057897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans653Open in IMG/M
3300025927|Ga0207687_10342413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1216Open in IMG/M
3300025932|Ga0207690_11275859All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300025933|Ga0207706_11602788All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300025960|Ga0207651_11416858All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300025960|Ga0207651_11898257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300026075|Ga0207708_11528118All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300026116|Ga0207674_11572683All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300026118|Ga0207675_101937378All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300026452|Ga0256821_1010527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria909Open in IMG/M
3300026523|Ga0209808_1121785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1068Open in IMG/M
3300027277|Ga0209846_1021438Not Available1054Open in IMG/M
3300027513|Ga0208685_1085445Not Available679Open in IMG/M
3300027717|Ga0209998_10013746All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300027722|Ga0209819_10005254Not Available4114Open in IMG/M
3300027835|Ga0209515_10646650Not Available523Open in IMG/M
3300027873|Ga0209814_10035216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2072Open in IMG/M
3300027874|Ga0209465_10131014All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300027880|Ga0209481_10512730All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300027907|Ga0207428_10602498All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300028828|Ga0307312_10326780All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300030620|Ga0302046_10437484All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300031847|Ga0310907_10790335All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031852|Ga0307410_10706267All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300031901|Ga0307406_12048428All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031911|Ga0307412_10493219All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300031912|Ga0306921_10404018All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300031947|Ga0310909_10563318All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300031965|Ga0326597_10010543All Organisms → cellular organisms → Bacteria → Proteobacteria12295Open in IMG/M
3300031965|Ga0326597_10016016All Organisms → cellular organisms → Bacteria9783Open in IMG/M
3300031965|Ga0326597_10341215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1687Open in IMG/M
3300031965|Ga0326597_11083348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium801Open in IMG/M
3300031995|Ga0307409_100513558All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300032017|Ga0310899_10245575All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300032828|Ga0335080_11117903All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300033414|Ga0316619_12217759All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300033551|Ga0247830_10825002All Organisms → cellular organisms → Bacteria738Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.94%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.94%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.94%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.98%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.98%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.98%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025555Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026452Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_106387613300000881SoilDTVIKKARQMITTAKPDSLVGMFQFGALKHEQVMHSLELFGAKVMPVLGD*
F14TB_10350724713300001431SoilDCLVGMFSFGGLKHEQVMRSIELFATKVMPALGA*
Ga0055465_1023461013300004013Natural And Restored WetlandsRAMMETAKPDSLVGMFSFGGLSHDQVTRSIELFATKVKPALGL*
Ga0065705_1015755733300005294Switchgrass RhizospherePETVIKKARMMIETAKPDSLVGMFQFGGLKHEQVMHSLELFGTKVMPALGA*
Ga0065707_1055074613300005295Switchgrass RhizosphereLMIETARPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGD*
Ga0065707_1058452013300005295Switchgrass RhizosphereARLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA*
Ga0065707_1069513923300005295Switchgrass RhizosphereKKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA*
Ga0070660_10042728613300005339Corn RhizosphereAKAREMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM*
Ga0066698_1030744923300005558SoilARPDCLVGMFSFGGLNHEQVMRSIELFATKVMPALGA*
Ga0066905_10122757313300005713Tropical Forest SoilKARVMIETARPDCLVGMFSFGGLTHEQIAHSIKLFGTKVMPALGA*
Ga0066905_10218871423300005713Tropical Forest SoilRLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA*
Ga0066903_10455012133300005764Tropical Forest SoilEAARPDCLVGMFSFGGLSHEQVTRSIELFATKVMPALG*
Ga0066903_10909088023300005764Tropical Forest SoilVVKKARLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATQVMPALGN*
Ga0075287_104597013300005873Rice Paddy SoilTARPDCLVGMFSFGGLKHEQVMRSIELFATKVMPALGA*
Ga0066652_10156942023300006046SoilSPDTVIKKARVMIETARPDTLVGMFSFGGLHHEQVMHSIELFATKVIPALGA*
Ga0075421_10190292013300006845Populus RhizosphereLTVKRLDEWGTSLIGSPATVISKARAMIETAKPDSLVGMFQFGGLKHEQVMHSLELFGNKVIPALGS*
Ga0079217_1010501323300006876Agricultural SoilTAKPDCLVGMFSFGGLRHEQVMRSIELFGTKVMPVLGA*
Ga0079216_1024694613300006918Agricultural SoilTVIKKARQMIETAKPDCLVGMFSFGGLKHEQVMHSIELFGTKVMPVLGA*
Ga0075419_1008038613300006969Populus RhizospherePETVIKKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA*
Ga0079218_1049945933300007004Agricultural SoilDTAKPDCLVGMFSFGGLRHEQVMRSIELFGTKVMPVLGA*
Ga0075435_10026288113300007076Populus RhizosphereARPDTLVGMFSFGGLRHEQVMRSIELFATKVMPALEM*
Ga0111539_1033358713300009094Populus RhizosphereREMIAIARPDTLVGMFSFGGLRHEQVMRSIELFATKVMPALGM*
Ga0111539_1065552813300009094Populus RhizosphereSARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA*
Ga0105092_1003124133300009157Freshwater SedimentSPETVIKKARAMIETARPDSLVGMFRFGGLSHTQVTRSIELFGTKVMPALGA*
Ga0105092_1086702823300009157Freshwater SedimentETARPDSLVGMFSFGGLSHAQVSRSIELFGAKVMPVLGA*
Ga0113563_1041539333300009167Freshwater WetlandsITTAKPDSLVGMFQFGALKHEQVMHSLGLFGAKVMPALGDW*
Ga0105088_102108013300009810Groundwater SandPDSLVGMFSFGGLSHQQVTRSIELFGTKVMPALGV*
Ga0105058_119132413300009837Groundwater SandIETAKPDSLVGMFSFGGLKHEQVMHSLELFGSKVMPALGA*
Ga0126380_1165851223300010043Tropical Forest SoilRPDCLVGMFSFGGLSHEQIMHSLELFGTKVIPAIG*
Ga0126377_1152708413300010362Tropical Forest SoilETARPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGLDTRKK*
Ga0134121_1041399513300010401Terrestrial SoilSARPDTLVGMFSFGGLQHQQVMRSIENFGTKIIPALGM*
Ga0137428_111014813300011432SoilKKARMMIETARPDCLVGMCSFGGLSHEQVMRSIELFGTHVIAALKNKPAAL*
Ga0137431_102389213300012038SoilRAMIETAKPDSLVGMFSFGGLKHEQVMHSLELFGSKVIPALGA*
Ga0137399_1168858923300012203Vadose Zone SoilNTVIKKARVMIETARPDSLVGMFSFGGLKHEQVMHSIELFATKVMPALGA*
Ga0137369_1016933213300012355Vadose Zone SoilTARPDCLVGMFSFGGLKHEQVMRSIELFATKVMPALGG*
Ga0137384_1064659913300012357Vadose Zone SoilTVLKKARQMIETARPDCLVGMFSFGGLSNEQVMRSIELLATKVKPFLDGI*
Ga0137375_1105936213300012360Vadose Zone SoilLIGMFQFGGPRHDQVMHSIELFAERVIPALAAEVAAPAI*
Ga0157351_103698113300012501Unplanted SoilTVIKKARAMIETARPDSLVGMFSFGGLSHQQVTRSIELFGTQVMPALGRVT*
Ga0157354_100321713300012517Unplanted SoilKARVMIESARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA*
Ga0157352_101003013300012519Unplanted SoilIGSPQTVIEKAREMIAITRPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM*
Ga0137358_1032369613300012582Vadose Zone SoilPETVLKKARSMIDTARPDSLVGMFSFGGLSHAQVTRSIELFGTKVMLALGD*
Ga0157284_1033208513300012893SoilREMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM*
Ga0137413_1104480123300012924Vadose Zone SoilIESARPDSLVGMFSFGGLKQEQVMHSIELFATKVMPALGA*
Ga0137404_1212730713300012929Vadose Zone SoilKARQMIETAKPDSLVGMFSFGGLSHQQVMRSIELFGTKVMPALGA*
Ga0164300_1001666743300012951SoilTSLIGSPQTVIAKAREMIAIARPDTLVGMFSFGGLQHQQAMRSIENFGTKVIPALGM*
Ga0134076_1011485823300012976Grasslands SoilDCLVGMFSFGGLNHEQVMRSIELFATKVMPALGA*
Ga0157375_1222792513300013308Miscanthus RhizosphereAKPDSLVGMFSFGGLKHEQVMHSIELFASKVMPALGA*
Ga0157375_1311740113300013308Miscanthus RhizospherePDTLVGMFSFGGLQHEQVMRSIELFATKVIPTLGM*
Ga0075313_110168723300014267Natural And Restored WetlandsRPDSLVGMFSFGGLSHQQVTRSIELFATQVMPALGA*
Ga0137412_1092488913300015242Vadose Zone SoilDSLVGMFSFGGLKHEQVMHSIELFATRVMPALGA*
Ga0132257_10204955813300015373Arabidopsis RhizosphereRVMIESARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA*
Ga0132257_10334062323300015373Arabidopsis RhizosphereARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA*
Ga0132257_10462049413300015373Arabidopsis RhizosphereKAREMIAIARPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM*
Ga0182037_1016475533300016404SoilREMIAIARPDTLVGMFSFGGLRHEQVMHSIELFATKVMPALGM
Ga0134069_111177433300017654Grasslands SoilRPDCLVGMFSFGGLSHEQVMRSIELFATKVKPFLDGI
Ga0163161_1121632713300017792Switchgrass RhizospherePDTVIKKARQMITTAKPDSLVGMFQFGALKHEQVMHSLELFGAKVMPALGD
Ga0184604_1002407323300018000Groundwater SedimentPETVLKKARSMIETAKPDSLVGMFSFGGLKHEQVMHSIELFASKVMPALGA
Ga0184638_105173313300018052Groundwater SedimentKARMMIETARPDCLVGMCSFGGLSHEQVSRSIELFGTKVIPALKNECAGK
Ga0184623_1023903433300018056Groundwater SedimentMIETARPDCLVGMFSFGGLSHEQITHSIELFGTKVMPALGG
Ga0184637_1023550533300018063Groundwater SedimentPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGR
Ga0066669_1132560813300018482Grasslands SoilMIETARPDSLVGMFSFGGLKHEQVMHSIELFATKVMPALGA
Ga0222622_1010108223300022756Groundwater SedimentMIETARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA
Ga0209002_1030559823300025289SoilMIATAKPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGG
Ga0209641_1092346833300025322SoilHRGGQGAAVVSHGIVARAMIATAKPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGG
Ga0209342_1030439513300025326SoilVSHGIVARAMIATAKPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGG
Ga0210121_105789723300025555Natural And Restored WetlandsSPDTVIKKAHAMLATAKPDSLVGMFQFGGLKHEQVRHSLELFGTKVMPALGA
Ga0207687_1034241343300025927Miscanthus RhizosphereTVLAKAREMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM
Ga0207690_1127585913300025932Corn RhizosphereARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM
Ga0207706_1160278813300025933Corn RhizospherePDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA
Ga0207651_1141685813300025960Switchgrass RhizosphereVLAKAREMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM
Ga0207651_1189825713300025960Switchgrass RhizosphereETVVKKAREMIETARPDCLVGMFSFGGLSHAQVMHSIDLFAKKVMPALRENS
Ga0207708_1152811823300026075Corn, Switchgrass And Miscanthus RhizosphereTVLKKARSMIETAKPDSLVGMFSFGGLKHEQVMHSIELFAAKVMPALGA
Ga0207674_1157268313300026116Corn RhizosphereKKARSMIETAKPDSLVGMFSFGGLKHEQVMHSIELFAAKVMPALGA
Ga0207675_10193737823300026118Switchgrass RhizosphereNTVIKKARVMIESARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA
Ga0256821_101052713300026452SedimentVVKKAREIIATARPDCLVGMFSFGGLSHAQVTRSIELFGTQVMPRLRAEPLG
Ga0209808_112178533300026523SoilETARPDCLVGMFSFGGLSHEQVMRSIELFATKVKPFLDGI
Ga0209846_102143823300027277Groundwater SandTVIKKARSMIETAKPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGV
Ga0208685_108544523300027513SoilVIKKARAMIETARPDSLVGMFSFGGLSHQQVTRSIELFATKVMPALGA
Ga0209998_1001374633300027717Arabidopsis Thaliana RhizosphereVATARPDCLVGMFSFGGLKHEQVMRSIELFATKVMPALGS
Ga0209819_1000525413300027722Freshwater SedimentKARAMIETARPDSLVGMFSFGGLNHAQVTRSIELFGTKVMPALGA
Ga0209515_1064665023300027835GroundwaterDSLVGIFSFGGLSHAQVIRSLELFATRVIPALADESVGP
Ga0209814_1003521613300027873Populus RhizospherePETVIKKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA
Ga0209465_1013101433300027874Tropical Forest SoilTARPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGA
Ga0209481_1051273023300027880Populus RhizosphereTVIKKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA
Ga0207428_1060249823300027907Populus RhizosphereIAIARPDTLVGMFSFGGLRHEQVMRSIELFATKVMPALGM
Ga0307312_1032678013300028828SoilETARPDTLVGMFSFGGLHHEQVMHSIELFATKVIPALGA
Ga0302046_1043748413300030620SoilMARPDCLVGLFSFGGQSHAQVTRSIELFATRVMPFLAD
Ga0310907_1079033523300031847SoilLIGSPQTVLAKTRAMIETAKPDSLVGMFSFGGLSHDQVTRSIELFANKVRPALGL
Ga0307410_1070626713300031852RhizosphereMIETAKPDSLVGMFSFGGLSHDQVTRSIELFATEVRPALGS
Ga0307406_1204842823300031901RhizosphereIGSPHTVIKKARMMIAMARPDSLVGMFQFGGLKHEQVMHSIELFGAKVMPALGA
Ga0307412_1049321913300031911RhizosphereHTVIKKARMMIAMARPDSLVGMFQFGGLKHEQVMHSIELFGAKVMPALGA
Ga0306921_1040401833300031912SoilAREMIAIARPDTLVGMFSFGGLRHEQVMHSIELFATKVMPALGM
Ga0310909_1056331823300031947SoilTSLISSPQTVLAKAREMIAIARPDTLVGMFSFGGLRHEQVMHSIELFATKVMPALGM
Ga0326597_1001054363300031965SoilMIATAKPDSLVGMFSFGGCLSHEQVMRSIELFATKVMPGLAG
Ga0326597_1001601673300031965SoilMRSWFVLEMIETAKPDSLVSMFSFGGLSHEQVMRSIELFATEVMPALGG
Ga0326597_1034121513300031965SoilDTVVKKARAMIETARPDSLVGMFSFGGLKHEQVMHSLELFGGKVMPALGA
Ga0326597_1108334823300031965SoilVLETIATAKPDSLVGMFSFGGLSHEQVIRSIELFATKVMPGLGG
Ga0307409_10051355813300031995RhizosphereDEWGTSLIGSPHTVIKKARMMIAMARPDSLVGMFQFGGLKHEQVMHSIELFGAKVMPALG
Ga0310899_1024557523300032017SoilTVIEKVREVIAIARPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM
Ga0335080_1111790323300032828SoilPETVIEKARAMIETARPDCLVGMFSFGGLSHEQVMRSIELFATTVMPAIG
Ga0316619_1221775923300033414SoilETVIKKARAMMATAKPDSLVGMFQFGGLKHEQVMHSLELFGTKVMPALGT
Ga0247830_1082500223300033551SoilAREMIAIARPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.