NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101963

Metagenome / Metatranscriptome Family F101963

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101963
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 115 residues
Representative Sequence MRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Number of Associated Samples 88
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.67 %
% of genes near scaffold ends (potentially truncated) 35.29 %
% of genes from short scaffolds (< 2000 bps) 81.37 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.74

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.529 % of family members)
Environment Ontology (ENVO) Unclassified
(32.353 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.235 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 73.29%    β-sheet: 0.00%    Coil/Unstructured: 26.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.74
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
f.61.1.1: Multidrug and toxic compound extrusion (MATE) transportersd3mkua_3mku0.65973
f.37.1.1: ABC transporter transmembrane regiond3g60a13g600.64279
f.37.1.0: automated matchesd6raha16rah0.64182
f.35.1.1: Multidrug efflux transporter AcrB transmembrane domaind1iwga71iwg0.63972
f.33.1.1: Metal cation-transporting ATPase, transmembrane domaind2zxea42zxe0.63728


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF09527ATPase_gene1 52.94
PF00119ATP-synt_A 16.67
PF00430ATP-synt_B 2.94
PF07883Cupin_2 0.98
PF13483Lactamase_B_3 0.98
PF00202Aminotran_3 0.98
PF00149Metallophos 0.98
PF14849YidC_periplas 0.98
PF00990GGDEF 0.98
PF13419HAD_2 0.98
PF01252Peptidase_A8 0.98
PF00137ATP-synt_C 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 16.67
COG0711FoF1-type ATP synthase, membrane subunit b or b'Energy production and conversion [C] 2.94
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 1.96
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_100211239All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium585Open in IMG/M
3300004114|Ga0062593_101343580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales760Open in IMG/M
3300004479|Ga0062595_101323370All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales650Open in IMG/M
3300004633|Ga0066395_10130505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1251Open in IMG/M
3300004643|Ga0062591_101435193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales686Open in IMG/M
3300005294|Ga0065705_11084790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca526Open in IMG/M
3300005329|Ga0070683_100226707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1776Open in IMG/M
3300005332|Ga0066388_101565659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1157Open in IMG/M
3300005332|Ga0066388_104660237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales698Open in IMG/M
3300005355|Ga0070671_100116938All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae2242Open in IMG/M
3300005455|Ga0070663_100149303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1791Open in IMG/M
3300005456|Ga0070678_101144534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus720Open in IMG/M
3300005564|Ga0070664_100447934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1185Open in IMG/M
3300005937|Ga0081455_10229048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1373Open in IMG/M
3300005983|Ga0081540_1000137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales78366Open in IMG/M
3300005983|Ga0081540_1322530All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300006163|Ga0070715_10343587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae813Open in IMG/M
3300006237|Ga0097621_100286574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus1451Open in IMG/M
3300006358|Ga0068871_101623472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae612Open in IMG/M
3300006574|Ga0074056_10784707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae692Open in IMG/M
3300006575|Ga0074053_11175141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae732Open in IMG/M
3300006579|Ga0074054_11302395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales889Open in IMG/M
3300006854|Ga0075425_100972899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium969Open in IMG/M
3300009168|Ga0105104_10000054All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales72102Open in IMG/M
3300009792|Ga0126374_10006534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae4230Open in IMG/M
3300010043|Ga0126380_11925392All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium539Open in IMG/M
3300010046|Ga0126384_10485878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1062Open in IMG/M
3300010046|Ga0126384_12005965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium553Open in IMG/M
3300010048|Ga0126373_10179483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2036Open in IMG/M
3300010048|Ga0126373_10408079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1385Open in IMG/M
3300010360|Ga0126372_10607423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1051Open in IMG/M
3300010360|Ga0126372_10882855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium895Open in IMG/M
3300010360|Ga0126372_12625637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium555Open in IMG/M
3300010362|Ga0126377_12548895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium587Open in IMG/M
3300010376|Ga0126381_100267519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2325Open in IMG/M
3300010376|Ga0126381_100514177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1691Open in IMG/M
3300010398|Ga0126383_10315108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1569Open in IMG/M
3300010398|Ga0126383_10403503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1404Open in IMG/M
3300011107|Ga0151490_1676164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium892Open in IMG/M
3300015371|Ga0132258_10051172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales9450Open in IMG/M
3300015371|Ga0132258_10227888All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales4538Open in IMG/M
3300015371|Ga0132258_10894943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae2241Open in IMG/M
3300015372|Ga0132256_102931400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium574Open in IMG/M
3300016371|Ga0182034_11387877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium614Open in IMG/M
3300016387|Ga0182040_10711824All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium821Open in IMG/M
3300016404|Ga0182037_10973400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium738Open in IMG/M
3300016445|Ga0182038_11187050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium680Open in IMG/M
3300017959|Ga0187779_10206723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1230Open in IMG/M
3300017974|Ga0187777_10760523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium690Open in IMG/M
3300021377|Ga0213874_10122412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium885Open in IMG/M
3300021445|Ga0182009_10337181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium767Open in IMG/M
3300021560|Ga0126371_12568102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium617Open in IMG/M
3300025461|Ga0208851_1000248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales24762Open in IMG/M
3300025920|Ga0207649_10003471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae8613Open in IMG/M
3300025931|Ga0207644_10166010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1720Open in IMG/M
3300027743|Ga0209593_10181901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium746Open in IMG/M
3300027874|Ga0209465_10121492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1288Open in IMG/M
3300027902|Ga0209048_10272108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1198Open in IMG/M
3300031543|Ga0318516_10100396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1635Open in IMG/M
3300031543|Ga0318516_10679862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium585Open in IMG/M
3300031546|Ga0318538_10022794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae2820Open in IMG/M
3300031561|Ga0318528_10292809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium874Open in IMG/M
3300031562|Ga0310886_10244832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus1000Open in IMG/M
3300031640|Ga0318555_10074406All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1761Open in IMG/M
3300031668|Ga0318542_10434284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium680Open in IMG/M
3300031681|Ga0318572_10052822All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae2193Open in IMG/M
3300031744|Ga0306918_11351966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium547Open in IMG/M
3300031747|Ga0318502_10466359All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium755Open in IMG/M
3300031765|Ga0318554_10294619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium923Open in IMG/M
3300031771|Ga0318546_10156703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1538Open in IMG/M
3300031781|Ga0318547_10035763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae2591Open in IMG/M
3300031799|Ga0318565_10484444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium598Open in IMG/M
3300031821|Ga0318567_10517260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium678Open in IMG/M
3300031845|Ga0318511_10337385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium685Open in IMG/M
3300031846|Ga0318512_10069746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1605Open in IMG/M
3300031847|Ga0310907_10182853All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus989Open in IMG/M
3300031860|Ga0318495_10518182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium519Open in IMG/M
3300031896|Ga0318551_10185448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1147Open in IMG/M
3300031896|Ga0318551_10789848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium552Open in IMG/M
3300031908|Ga0310900_11950026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium502Open in IMG/M
3300031942|Ga0310916_10946417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium721Open in IMG/M
3300031954|Ga0306926_12543321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium560Open in IMG/M
3300031981|Ga0318531_10516364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium541Open in IMG/M
3300032010|Ga0318569_10149377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1075Open in IMG/M
3300032039|Ga0318559_10162088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1019Open in IMG/M
3300032066|Ga0318514_10104039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1443Open in IMG/M
3300032076|Ga0306924_11899826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium617Open in IMG/M
3300032091|Ga0318577_10456713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium610Open in IMG/M
3300032261|Ga0306920_101831143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium855Open in IMG/M
3300032261|Ga0306920_102862493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium655Open in IMG/M
3300032421|Ga0310812_10406411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium612Open in IMG/M
3300032770|Ga0335085_10211483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2366Open in IMG/M
3300032770|Ga0335085_10543485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1318Open in IMG/M
3300032782|Ga0335082_10383393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1271Open in IMG/M
3300032783|Ga0335079_10035176All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae5751Open in IMG/M
3300032829|Ga0335070_10002007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales23682Open in IMG/M
3300032893|Ga0335069_10100552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales3655Open in IMG/M
3300032954|Ga0335083_10337330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1310Open in IMG/M
3300033004|Ga0335084_11121067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium789Open in IMG/M
3300033480|Ga0316620_10838385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium884Open in IMG/M
3300033513|Ga0316628_100006028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae9831Open in IMG/M
3300034150|Ga0364933_026889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1394Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil14.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.94%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.96%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10021123913300000955SoilMRLLGFMCALALVGAVGWWLTGTPATRAGVVGSVVASAVVLVGKSIAVRRSIKVALGASVAGLVLRLGAWFGGYRWVRAQHEDVGAYTLAFFGLFVVALCLEMTYVLVAA
Ga0062593_10134358023300004114SoilMRLLAFVGLLLLVGALGWWATSTQATHAGVVASAVASVVTLVGMALALRRSILVALWISVAGMVVRLGAWFAGYRWVRMQHEDVRAYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0062595_10132337023300004479SoilMRLLGFMGALMLVGAMGWWVTGTPATRTGVVVSVLASTVVLVGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT*
Ga0066395_1013050523300004633Tropical Forest SoilMRLLAFVVLLGLVGALGWWATGTPATRVGVVASVAASALVLVVTSIALRRSLVVALWMSVAGMLLRLGVWFVGYRSVRGEHEDVRAYTFAFFAAFVVALCLEMTYVLAAAKGQRRGAT*
Ga0062591_10143519313300004643SoilMRLLAFVGLLLLVGALGWWATSTQATHAGVVASAVASVVTLVGMALALRRSILVALWISVAGMVVRLGAWFAGYRWVRMQHEDVRAYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0065705_1108479013300005294Switchgrass RhizosphereMRLLGFMGALLVIGAVGWWATGTPATRTGVVASVLASAVVLIGKSIAVRRSIQVALGASVAGLVLRLAAWFVGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARSQRRGAT*
Ga0070683_10022670733300005329Corn RhizosphereMRLLGFMGALFLIGAVGWWATGTLATRMGVVASVLASAMVLVGKSIAIRRSIQVALGASVVGLVLRLAVWFVGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT*
Ga0066388_10156565923300005332Tropical Forest SoilMRLLGFVGLLLLVGALGWWVTSTQATHAGVVASAAASVVALVGMALALRRSILVALWISVAGMVVRLGTWFAGYRWVRAQHQDVRDYTFAFLGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0066388_10466023723300005332Tropical Forest SoilMRLLGFMGALVLIGAVGWWATGTPATRTGVVVSVLASAVVLVGKSIAVRRSIQVALGASLAGLVLRLAAWFAGYRWIRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT*
Ga0070671_10011693833300005355Switchgrass RhizosphereMRLIGFMGALLLIGAVGWWATGTPATRAGVVASILASAVVLVGKSIAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARHQRRGAM*
Ga0070663_10014930323300005455Corn RhizosphereMRLLAFVGLLVLVGALGWWATSTHATHVGVVASAVASMVALVGMALALRRSILVALWISVAGMVVRLGMWFAGYRWVRAQHEDVRAYTFAFFGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0070678_10114453423300005456Miscanthus RhizosphereLDEEVMRLLAFVGLLVLVGALGWWATSTHATHVGVVASAVASMVALVGMALALRRSILVALWISVAGMVVRLGMWFAGYRWVRAQHEDVRAYTFAFFGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0070664_10044793423300005564Corn RhizosphereMRLLAFVGLLLLVGALGRWATSTPATHAGVLASALASVVALVGMALALRRSILVALWISVAGMVVRLGMWFAGYRWVRAQHEDVRAYTFAFFGVFVVALCLEMTYVLAAAKGQRRGAT*
Ga0081455_1022904823300005937Tabebuia Heterophylla RhizosphereMRLLGFMGALALLGAVGWWATGTPATRAGVVVSVLASAVVLVGKSIAVRRSIQVALGASLAGLVLRVAAWFGGYRWVRAQHEDVGSYTLAFFGLFVVALCLEMTYVLAAARGQRRGAT*
Ga0081540_1000137263300005983Tabebuia Heterophylla RhizosphereMRLLGFMGALALLGAVGWWATGTPATRAGVVVSVLASAVVLVGKSIAVRRSIQVALGASLAGLVLRVAAWFGGYRWVRAQHEDVGAYTLTFFGVFVVALCLEMTYVLVAARGQRRGVT*
Ga0081540_132253013300005983Tabebuia Heterophylla RhizosphereMKLLGFMGALALIGAVGWWATGTPATRAGVVVSVLASAVVLVAKSFAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRSQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGATRCGGGCGAQCWRCRW
Ga0070715_1034358723300006163Corn, Switchgrass And Miscanthus RhizosphereMRLLGFMAALAVVGALGWWWAGTPATRAGVLASVLASVVVLVGKAFAVRKSIQVALGASVAGLVLRLAVWFGGYRWVRAQHEDVGSYTLAFFGLFVVALCLEMTYVLAAARGQRRGAT*
Ga0097621_10028657413300006237Miscanthus RhizosphereSTHATHVGVVASAVASMVALVGMALALRRSILVALWISVAGMVVRLGMWFAGYRWVRAQHEDVRAYTFAFFGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0068871_10162347223300006358Miscanthus RhizosphereMRLLAFVGLLVLVGALGWWATSTHATHVGVVASAVASMVALVGMALALRRSILVALWISVAGMVVRLGMWFAGYRWVRAQHEDVRAYTFAFFGVFVVALCLEMTYVLAAARG
Ga0074056_1078470713300006574SoilAVGWWLTGTVATRAGVVVSVVASLVVLVGKSVAVRRSIQVALGASVAGLVLRLGAWFGGYRWVQAQHEDVGAYTLAFFGLFVVALCLEMTYVLVAARGQRRGAT*
Ga0074053_1117514123300006575SoilALMLVGAVGWWVTGTPATRTGVVASVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGVT*
Ga0074054_1130239513300006579SoilMRLLGFMGALMLVGAVGWWMTGTPATRIGVVASVLASAVVLVGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLAAARSQRRGAT*
Ga0075425_10097289923300006854Populus RhizosphereMRLLAFVGLLVLVGALGWWATSTHATHVGVVASAVASMVALVGMALALRRSVLVALWISVAGMVVRLGMWFAGYRWVRAQHEDVRAYTFAFF*
Ga0105104_10000054363300009168Freshwater SedimentMRLLGFMGALLLIGAVGWWATGTPATRTGVVASVLASAVVLVGKSIAVRRSIQVALGVSVAGLVLRVAAWFVGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVVARGQRRGAT*
Ga0126374_1000653423300009792Tropical Forest SoilMRLLGFVGLLLLVGALGWWVTSTQATHAGVVASAAASVLALVGMALALRRSILVALWISVAGMVVRLGTWFAGYRWVRAQHQDVRDYTFAFLGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0126380_1192539213300010043Tropical Forest SoilMRLLGFMGALALVGAVGWWATGTESTRVGVVVSVLASAVVLVAKSIAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRSQHGDVGAYTLAFFGVFVVALCLEMTYVLVAARAQRRGAT*
Ga0126384_1048587823300010046Tropical Forest SoilMRLSAFIGLLVIVGALGLWATSTPATHAGVVASVVASAVALVGTSFALRLSILIALWVSVAGMVVRLGTWFAGYRWVRMQHEDVRAYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0126384_1200596513300010046Tropical Forest SoilMRLVAFVGLLALVGALGWWATGSPAARSGVLASVMASALVMVGTSIALRRSIGVALWMSVAGMVMRLGMWFVGYRWVRGQHQDVRAYTFA
Ga0126373_1017948333300010048Tropical Forest SoilMRLIAFIGLLVIVGALGLWATGTPATHAGVLVSVAASAVALVGTSIALRLSILIALWVSVAGMVVRLGGWFAGYRWVRTQHEDVRAYTLAFFGVFVVALCLEMTYVLAAAKG
Ga0126373_1040807923300010048Tropical Forest SoilLVVVGALGLWATGTPATHAGVVASIVTSAVVLVGTSVALRLSILIALWASVAGMVVRLGGWFAGYRWVRMQHEDVRAYTLAFFGVFVVALCLEMTYVLAASRGQRRGAT*
Ga0126372_1060742323300010360Tropical Forest SoilMRLLGFVGLLLLVGALGWWVTSTQATHVGVVASAAASVVALVGMALALRRSILVALWISVAGMVVRLGTWFAGYRWVRAQHQDVRDYTLAFLGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0126372_1088285533300010360Tropical Forest SoilMRLSAFIGLLIIVGALGLWATSTPATHAGVVASIVASAVALVGTSFALRLSILIALWVSVAGMVVRLGTWFAGYRWVRMQHEDVRAYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT*
Ga0126372_1262563723300010360Tropical Forest SoilEAMRLLGFMGALVLIGAVGWWATGTPATRTGVVVSVLASAVVLVGKSIAVRRSIQVALGASLAGLVLRLAAWFAGYRWIRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0126377_1254889523300010362Tropical Forest SoilMRLLGFMGALLLIGAVGWWATGTPATRMGVLASVLASAVVLIGKAIAVRRSIQVALGASVVGLVLRLAVWFVGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT*
Ga0126381_10026751933300010376Tropical Forest SoilMRLLGFMGALVLIGAIGWWATGTPATRAGVVASVLASAVVLVAKSFAVRRSIQMALGASLAGLVLRLAAWFGGYRWVRSLHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT*
Ga0126381_10051417723300010376Tropical Forest SoilMRLSAFIGLLVIVGALGLWATSTPATHAGVVASVVASAVALVGTSFALRLSILIALWVSVAGMVVRLGTWFAGYRWVRIQHEDVRAYTLAFFAVFVVALCLEMTYVLAAARGRRRGAT*
Ga0126383_1031510813300010398Tropical Forest SoilPELDEEVMRLVAFVGLLALVGALGWWATGSPAARSGVLASVTASALVMVGTSIALRRSIGVALWMSVAGMVMRLGMWFVGYRWVRGQHQDVRAYTFAFLGAFVVALCLEMTYVLAAARGQRRGAT*
Ga0126383_1040350313300010398Tropical Forest SoilMRLSAFIGLLVIVGALGLWATSTPATHAGVVASVVASAVALVGTSFALRLSILIALWVSVAGMVVRLGTWFAGYRWVRMQHEDVRAYTLAFFGVF
Ga0151490_167616423300011107SoilMRLLGFMGALMLVGAVGWWMTGTPATRIGVVASVLASAVVLVGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT*
Ga0132258_1005117253300015371Arabidopsis RhizosphereMRLLGFMGALALIGAVGWWATGTQATRAGVVVSVLASAVVLVAKSIAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRSQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT*
Ga0132258_1022788863300015371Arabidopsis RhizosphereMRLLGFIGALAVVGAVGWWLTGTVATRAGVVVSVVASLVVLVGKSVAVRRSIKVALGASVVGLVLRLGAWFGGYRWVQAQHEDVGAYTLAFFGLFVVALCLEMTYVLVA
Ga0132258_1089494323300015371Arabidopsis RhizosphereMRLLGFMGALFLIGAVGWWATGTLATRMGVVASVLASAMVLVGKSIAIRRSIQVALGASVVGLVLRLAVWFVGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGRRRGAT*
Ga0132256_10293140023300015372Arabidopsis RhizosphereMRLLGFIGALAVVGAVGWRLTGTVATHAGVVVSVVASLVVLVGKSVAVRRSIKVALGASVAGLVLRLGAWFGGYRWVQAQHEDVGAYTLAFFGLFVVALCLEMT
Ga0182034_1138787723300016371SoilLIGAVGWWATGTPATRAGVVVSVTASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0182040_1071182423300016387SoilMRLIGFMTALALIGAVGWWATGTPATRAGVVVSVTASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0182037_1097340023300016404SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRG
Ga0182038_1118705023300016445SoilTQRNEKAMRLIGFMSALTLIGAVGWWATGTLATRAGVVGSVLASAVVLVGKSIAVRKSIQVALGASVAGLVLRLAVWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0187779_1020672323300017959Tropical PeatlandMRLLVFMAALVGLGLVGWWATHTPETHAGVAVSVVASAVVLVGKSIAVRRSIQVALGASVAGLVLRLAAWFVGYRWVRAHQEDVGAYTLAFFGVFVVALCLEMTYVLVAAKAQRRGAT
Ga0187777_1076052323300017974Tropical PeatlandVGWWATHTPETHAGVAVSVVASAVVLVGKSIAVRRSIQVALGASVAGLVLRLAAWFVGYRWVRAHQEDVGAYTLAFFGVFVVALCLEMTYVLVAAKAQRRGAT
Ga0213874_1012241223300021377Plant RootsMRLVGFMGALALLGAVGWWATGTKATRAGVVVSVLSSAVVLVGKSVAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0182009_1033718123300021445SoilMRLLAFVGLLSLVGAVGWWATSTQATHAGVVVSAASSAVALVGMALAVRRSILVALWLSVAGMVVRLGAWFAGYRWVRVQHDDVRAYTFAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0126371_1256810223300021560Tropical Forest SoilMRLSAFIGLLIIVGALGLWATSTPATHAGVVASIVASAVALVGTSFALRLSILIALWVSVAGMMVRLGTWFAGYRWVRMQHEDVRAYTLAFFGVFVVALCLEM
Ga0208851_1000248253300025461Arctic Peat SoilMRLLGFIGALAAIGAVAWWLTGTVATRAGVVVSVLASVVVLLAKSVAVRRSIQVALGASVAGLVLRLGAWFGGYQWVRAQHEDVGSYTLAFFGLFVVALCLEMTYVLVAARGQRRGVT
Ga0207649_10003471103300025920Corn RhizosphereMRLLGFMGALFLIGAVGWWATGTLATRMGVVASVLASAMVLVGKSIAIRRSIQVALGASVVGLVLRLAVWFVGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0207644_1016601023300025931Switchgrass RhizosphereMGALLLIGAVGWWATGTPATRAGVVASILASAVVLVGKSIAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARHQRRGAM
Ga0209593_1018190123300027743Freshwater SedimentMRLLGFMGALLLIGAVGWWATGTPATRTGVVASVLASAVVLVGKSIAVRRSIQVALGVSVAGLVLRVAAWFVGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVVARGQRRGAT
Ga0209465_1012149223300027874Tropical Forest SoilMRLLAFVVLLGLVGALGWWATGTPATRVGVVASVAASALVLVVTSIALRRSLVVALWMSVAGMLLRLGVWFVGYRSVRGEHEDVRAYTFAFFAAFVVALCLEMTYVLAAAKGQRRGAT
Ga0209048_1027210833300027902Freshwater Lake SedimentMRLVGFLGALALVGVVGWWAMRGPATRAGVAVSVAASAVVLVGKSVAVRRSIQVALGASVVGLVLRLGAWFGGYRWVQAQHQDVGAYTLAFFGLFVVALCLEMTYVLVAARSQRRGVE
Ga0318516_1010039623300031543SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318516_1067986213300031543SoilALVGVLGWWATGTPAIQAGVLASVVASVLVLVGTSLALRRSILVALWMSVAGMVLRLGVWFAGYRWVRGQHEDVRDYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0318538_1002279443300031546SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGCRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318528_1029280913300031561SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGSYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0310886_1024483223300031562SoilMRLLAFMGALALIGAVGWWATGTQATRAGVVVSVLASAVVLVAKSIAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRSQHEDVGAYTLAFFGVFVVALCLEMTYVLAVARGQRRGAT
Ga0318555_1007440633300031640SoilLLRDDPGAQRDEQAMRLIGFMVALVLIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318542_1043428423300031668SoilMRLIGFMVALVLIGAVGWWATGTPATRAGVVVSVTASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318572_1005282243300031681SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0306918_1135196623300031744SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRR
Ga0318502_1046635923300031747SoilMRLIGFMAALALTGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318554_1029461923300031765SoilMRLIGFMTALALIGAVGWWATGTPATRTGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318546_1015670313300031771SoilWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGSYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318547_1003576343300031781SoilVAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318565_1048444423300031799SoilAVGWWATGTPATRTGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318567_1051726013300031821SoilVLIGAVGWWATGTPATRAGVVVSVTASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318511_1033738523300031845SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAASR
Ga0318512_1006974623300031846SoilMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0310907_1018285323300031847SoilMRLLAFMGALALIGAVGWWATGTQATRAGVVVSVLASAVVLVAKSIAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRSQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318495_1051818223300031860SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMT
Ga0318551_1018544813300031896SoilMRLATFLGLLALVGVLGWWATGTPAIQAGVLASVVASVLVLVGTSLALRRSILVALWMSVAGMVLRLGVWFAGYRWVRGQHEDVRDYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0318551_1078984813300031896SoilMRLIGFMTALALIGAVGWWATGTPATRTGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0310900_1195002623300031908SoilMRLLGFMGALALIGAVGWWATGTQATRAGVVVSVLASAVVLVAKSIAVRRSIQVALGASVAGLVLRLVAWFGGYRWVRSQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0310916_1094641723300031942SoilMRLIGFMSALALIGAVGWWATGTLATRAGVVGSVLASAVVLVGKSVAVRKSIQVALGASVAGLVLRLAVWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0306926_1254332113300031954SoilQRDEEVMRLATFLGLLALVGVLGWWATGTPAIQAGVLASVVASVLVLVGTSLALRRSILVALWMSVAGMVLRLGVWFAGYRWVRGQHEDVRDYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0318531_1051636413300031981SoilLALVGVLGWWATGTPAIQAGVLASVVASVLVLVGTSLALRRSILVALWMSVAGMVLRLGVWFAGYRWVRGQHEDVRDYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0318569_1014937723300032010SoilMRLIGFMVALVLIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318559_1016208823300032039SoilMRLIGFMAALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGSYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0318514_1010403923300032066SoilMRLIGFMSALALIGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLAAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0306924_1189982613300032076SoilMRLIGFMVALVLIGAVGWWATGTPATRAGVVVSVTASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVA
Ga0318577_1045671323300032091SoilTGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGAYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0306920_10183114323300032261SoilMRLATFLGLLALVGVLGWWATGTPAVLASVVASVLVLVGTSLALRRSILVALWMSVAGMVLRLGVWFAGYRWVRGQHEDVRDYTLAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0306920_10286249313300032261SoilFLRDDPGAQRDEQAMRLIGFMAALALTGAVGWWATGTPATRAGVVVSVLASAVVLLGKSIAVRRSIQVALGASLAGLVLRLVAWFGGYRWVRAQHEDVGSYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT
Ga0310812_1040641113300032421SoilWLTGAPAMRAGVLASVLASAVVLAGKAIAVRKSIQVALGASVAGLVLRLAVWFGGYRWVRAQHEDVGGYTLAFFGLFVVALCLEMTYVLAVARGQRRGAT
Ga0335085_1021148323300032770SoilMRLLAFVGLLLLVGALGWWATSTQATHAGVVLSAAASVIALLGTALALRRSILVALWISVAGMVVRLAAWFAGYRWVRVEHEDVRAYTFAFFGVFVVALCLEMTYVLAAARGQRRGAT
Ga0335085_1054348523300032770SoilMRLLGFLGALALIGAVGWWAMRTPATRAGLVASVLASAVVLVGKSIAVRRSIRVALGASVAGLVLRLGAWFGGYRWVQARNEDVGAYTLAFFGLFVVALCLEMTYVLVAAKAQRRGAT
Ga0335082_1038339313300032782SoilMRLVAFMGALVLVGAVGWWATRTPATRAGVVASVVASAVVLVGKSIAVRRSIQVALGASVAGLMLRLGAWFGGYRWVRAHHEDVGAYTLAFFGLFVVALCLEMTYVLVAARAQRRGAT
Ga0335079_1003517653300032783SoilMRLLAFIAGLVGLGLVGWWATHTPEAHAGVVVSVVASAVVLVGKSIAVRRSIQVALGASVAGLVLRLAAWFGGYRWVRARQEDVGAYTLAFFGVFVVALCLEMTYVLVAAKAQRRGAT
Ga0335070_10002007123300032829SoilMRLVAFMGALVLVGAVGWWATRTPATRAGVVASVVASAVVLVGKSIAVRRSIQVALGASVAGLMLRLGAWFGGYRWVRAHHEDVGAYTLAFFGLFVVALCLEMTYVLVAARGQRRGVT
Ga0335069_1010055233300032893SoilMRLLGFLGALAVLGVVGFWATGTPATRLGVVASVLASAVVLVGKSIALRRSIQVALGASVVGLLLRLAAWFLGYRWVRAQREDVGAYTLAFFGTFVVALCLEMTYVLVAARRQRRGAT
Ga0335083_1033733023300032954SoilMRLLAFIAALVGLGLVGWWATHTPEAHAGVVVSVVASAVVLVGKSIAVRRSIRVALGASVAGLVLRLAAWFVGYRWVRAQQEDVGAYTLAFFGVFVVALCLEMTYVLVAAKAQRRGAT
Ga0335084_1112106723300033004SoilMRLLGFMGALAVVGVVGWWATDTPATRAGVLAATLASAVVLVGKAIAVRKSIQVALGASVAGLVLRLAVWFGGYRWVKARSEDVGAYTLVFFGLFVVALCLEMTYVLAAARGQRRGAT
Ga0316620_1083838523300033480SoilAVGWWATRTPATRAGVVASVLASAVVLVGKSIAVRRSIRVALGASVAGLVLRLGAWFGGYRWVQARHGDEGAYTLAFFGLFVVALCLEMTYVLVAARAQRRGVT
Ga0316628_10000602813300033513SoilPERDEEAMRLLGFLGALVLIGAVGWWATRTPATRAGVVASVLASAVVLVGKSVAVRRSIQVALGASVAGLVLRLGAWFGGYRWVQARHDDVGAYTLAFFGLFVVALCLEMTYVLVAARAQRRGVT
Ga0364933_026889_931_12873300034150SedimentMRLAGFLGALALVGAVGWWMMSTPATRLGVVASVAASALVLVGKSIAVRRSIQVALGASVVGLVLRLGVWFGGYWWVRAQQEDVGTYTLAFFGVFVVALCLEMTYVLVAARGQRRGAT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.