Basic Information | |
---|---|
Family ID | F101839 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 47 residues |
Representative Sequence | MSTDINNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLAGITAVENDL |
Number of Associated Samples | 75 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 52.94 % |
% of genes near scaffold ends (potentially truncated) | 98.04 % |
% of genes from short scaffolds (< 2000 bps) | 92.16 % |
Associated GOLD sequencing projects | 67 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.039 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (14.706 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.725 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.608 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.68% β-sheet: 0.00% Coil/Unstructured: 51.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF13414 | TPR_11 | 13.73 |
PF13432 | TPR_16 | 4.90 |
PF13424 | TPR_12 | 1.96 |
PF08534 | Redoxin | 0.98 |
PF02472 | ExbD | 0.98 |
PF01565 | FAD_binding_4 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.04 % |
Unclassified | root | N/A | 1.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_13763626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
3300000890|JGI11643J12802_11469961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
3300003322|rootL2_10231611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4151 | Open in IMG/M |
3300004114|Ga0062593_100047685 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
3300004156|Ga0062589_101039711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300004157|Ga0062590_101836546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300004479|Ga0062595_102036730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300004643|Ga0062591_101236124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300005290|Ga0065712_10812019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300005293|Ga0065715_10517992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300005294|Ga0065705_10295646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
3300005331|Ga0070670_100391189 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300005331|Ga0070670_101129015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300005334|Ga0068869_100185479 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300005341|Ga0070691_10978820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300005353|Ga0070669_101058947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300005366|Ga0070659_100355211 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300005438|Ga0070701_10109192 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300005564|Ga0070664_101869901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300005564|Ga0070664_101887244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300005577|Ga0068857_100282664 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300005577|Ga0068857_101484658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300005577|Ga0068857_102416727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300005617|Ga0068859_100947409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
3300005617|Ga0068859_102139867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300005618|Ga0068864_100192662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1870 | Open in IMG/M |
3300005719|Ga0068861_100504204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300005841|Ga0068863_102128338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300006169|Ga0082029_1013349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300006844|Ga0075428_100961238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 905 | Open in IMG/M |
3300006852|Ga0075433_10474981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
3300006918|Ga0079216_10029569 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
3300006954|Ga0079219_10103943 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300006954|Ga0079219_11475588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300009098|Ga0105245_12433610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300009101|Ga0105247_11381824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300009148|Ga0105243_10462554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
3300009174|Ga0105241_10500112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
3300009174|Ga0105241_11309282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300009174|Ga0105241_11346818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300009174|Ga0105241_12259371 | Not Available | 541 | Open in IMG/M |
3300009174|Ga0105241_12460672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300009176|Ga0105242_10012256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6598 | Open in IMG/M |
3300009551|Ga0105238_11580149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300009553|Ga0105249_12506344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300009553|Ga0105249_12567534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300009553|Ga0105249_13128983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300009553|Ga0105249_13535321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300010037|Ga0126304_10845015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300010040|Ga0126308_10251069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
3300010040|Ga0126308_11110887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300010042|Ga0126314_11345482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300010044|Ga0126310_10357303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
3300010045|Ga0126311_11110260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300010046|Ga0126384_10535392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
3300010166|Ga0126306_11870264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300010371|Ga0134125_11660297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300010375|Ga0105239_10750744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300010397|Ga0134124_11614077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300010399|Ga0134127_11207040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300010399|Ga0134127_11209898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
3300010399|Ga0134127_12476249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300010399|Ga0134127_12679110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300010403|Ga0134123_11372088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300011119|Ga0105246_10402638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
3300011119|Ga0105246_11713251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300011119|Ga0105246_11927405 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300013102|Ga0157371_11558242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300013297|Ga0157378_11161496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300013297|Ga0157378_11376692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300013306|Ga0163162_12624660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300013308|Ga0157375_11051946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300013308|Ga0157375_12969986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300014325|Ga0163163_11208645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300014326|Ga0157380_11223015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300014745|Ga0157377_10476059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300014968|Ga0157379_12657844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300018476|Ga0190274_13845164 | Not Available | 508 | Open in IMG/M |
3300025912|Ga0207707_11484287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300025918|Ga0207662_10186606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1336 | Open in IMG/M |
3300025923|Ga0207681_10797659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300025925|Ga0207650_10316740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
3300025926|Ga0207659_11543733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300025935|Ga0207709_10377050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
3300025935|Ga0207709_10931692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300025936|Ga0207670_11906336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300025938|Ga0207704_11961450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300026035|Ga0207703_10146093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2057 | Open in IMG/M |
3300026035|Ga0207703_10321456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
3300026035|Ga0207703_11033065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300026088|Ga0207641_10284690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1556 | Open in IMG/M |
3300026095|Ga0207676_10144098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2044 | Open in IMG/M |
3300026095|Ga0207676_10900290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300026095|Ga0207676_12044783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300026116|Ga0207674_11310766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300026118|Ga0207675_101958743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300027639|Ga0209387_1048513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
3300028381|Ga0268264_10070844 | All Organisms → cellular organisms → Bacteria | 2952 | Open in IMG/M |
3300028381|Ga0268264_10119144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2324 | Open in IMG/M |
3300031824|Ga0307413_10316789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
3300031911|Ga0307412_10508834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300032074|Ga0308173_10915703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 14.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 7.84% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.86% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.90% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_137636261 | 3300000363 | Soil | MEMAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQDKEYLASITSVENDLI |
JGI11643J12802_114699613 | 3300000890 | Soil | MVANPFSEKLIAQYLLGELPEEKQVEIEDRAFGDAELMASITAVENDLIDEYVREEMPASDR |
rootL2_102316112 | 3300003322 | Sugarcane Root And Bulk Soil | MSADLKSEKLITQYLLGELPEEQQVEIEDRAFSDQDFLASITSVENDLID |
Ga0062593_1000476854 | 3300004114 | Soil | MADLNSEKLITQYLLGELPEEQQIEIEDRAFGDKEFLANITA |
Ga0062589_1010397111 | 3300004156 | Soil | MAADLNNEKLIARYLLGELPEEQQVEIEDRAFTDKDYLASITAVENDLIDEYVRHE |
Ga0062590_1018365462 | 3300004157 | Soil | MSTDINNEKLISRYLLGELPEDQQVEIEDRAFSDKDYLASITAVENDLI |
Ga0062595_1020367301 | 3300004479 | Soil | MSVDINNEKLIVRYLLGELPEEQQVEIEDRAFSDKDYLASIT |
Ga0062591_1012361242 | 3300004643 | Soil | LRETSKPMTTDIKNETLIARYLLGELPEEQQVEIEDRAFS |
Ga0065712_108120192 | 3300005290 | Miscanthus Rhizosphere | MATDLNSESVIARYLLGELSEEQQVEIEDRAFADHKYLASITAVENDLIDE |
Ga0065715_105179921 | 3300005293 | Miscanthus Rhizosphere | MATDLNNETLIARYLLGELSEEQQIEIEDRAFADTDYLASVTAVENDLIDEYV |
Ga0065705_102956461 | 3300005294 | Switchgrass Rhizosphere | MATDLNNESVIARYLLGELSEEQQVEIEDRAFADQKYLASITAVENDLIDE |
Ga0070670_1003911891 | 3300005331 | Switchgrass Rhizosphere | MASGRSPTEHMSANLNETLIARYLLGELSDDQQVEIEDRAFSDKEYLATIT |
Ga0070670_1011290152 | 3300005331 | Switchgrass Rhizosphere | MATDLNSENLIARYLLGELSEEQQVEIEDRAFADQKYLAS |
Ga0068869_1001854793 | 3300005334 | Miscanthus Rhizosphere | MATDLNSESVIARYLLGELSEEQQVEIEDRAFADQKYLAS |
Ga0070691_109788202 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVDNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLATITTVEND |
Ga0070669_1010589471 | 3300005353 | Switchgrass Rhizosphere | MEMAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQDKEYLASITSVENDL |
Ga0070659_1003552111 | 3300005366 | Corn Rhizosphere | MSTDINNEKLISRYLLGELPEEQQVEIEDRAFSDKDYVASITAVENDL |
Ga0070701_101091923 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MATDLMSEKLINRYLLGELPEEQQVEIEDRAFSDQEFMAIITAAENDLIDEY |
Ga0070664_1018699011 | 3300005564 | Corn Rhizosphere | MSVNNEKLISQYLLGELPEEQQVEIEDRAFSDTEYLASITAVEND |
Ga0070664_1018872441 | 3300005564 | Corn Rhizosphere | MSVENETLIAQYLLGELPEEQQVQIEDRAFADKDYLATITAVENDLIDEYV |
Ga0068857_1002826641 | 3300005577 | Corn Rhizosphere | MSVNNEKLISQYLLGELPEEQQVEIEDRAFSDTEYLASITAVENDLIDEYVRGE |
Ga0068857_1014846581 | 3300005577 | Corn Rhizosphere | MEMAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQDKEYLASITSVE |
Ga0068857_1024167271 | 3300005577 | Corn Rhizosphere | MSTDINNEKLISRYLLGELPEEQQVEIEDRAFSDNDYLAGITTVENDLIDEYVR |
Ga0068859_1009474092 | 3300005617 | Switchgrass Rhizosphere | MATDLNNETLIARYLLGELSEEQQVEIEDRAFEDKDYLASITAVENDLIDEYV |
Ga0068859_1021398672 | 3300005617 | Switchgrass Rhizosphere | MSVDNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLATI |
Ga0068864_1001926621 | 3300005618 | Switchgrass Rhizosphere | MSPDLKSENLITQYLLGELREEQQVEIEDRAFSDQEFM |
Ga0068861_1005042041 | 3300005719 | Switchgrass Rhizosphere | MSVDNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLATITTV |
Ga0068863_1021283382 | 3300005841 | Switchgrass Rhizosphere | MADLNSEKLITQYLLGELPEEQQIEIEDRAFGDKEFLANITAV |
Ga0082029_10133492 | 3300006169 | Termite Nest | MSADLKSEKLIAQYLLGELTEEQQVEIEDRAFGDDA |
Ga0075428_1009612381 | 3300006844 | Populus Rhizosphere | MSADVNNEKLIAQYLLGELPEEQQVEIEDRAFADKEYLASITAVENDLIDEYARNELSESERR |
Ga0075433_104749811 | 3300006852 | Populus Rhizosphere | MATDLNSENVIARYLLGELSEEQQVQIEDRAFADQKYLASITAV |
Ga0079216_100295694 | 3300006918 | Agricultural Soil | MAAEPNSEKLIAQYLLGELGEEQQVEIEDRAFSDPEFLAS |
Ga0079219_101039433 | 3300006954 | Agricultural Soil | MSNDINQEKLISQYLLGELPEEQQVEIEDRAFSDKEYLAGITAVENDLID |
Ga0079219_114755881 | 3300006954 | Agricultural Soil | MAADLNNEKLIAQYLLGDLPEEQQVAIEDRAFSDNDYLAL |
Ga0105245_124336102 | 3300009098 | Miscanthus Rhizosphere | MAADFKNINNEKLIAQYLLGELPEEQQVEIEDRAFSDKDYLASITAVENDLVDEY |
Ga0105247_113818242 | 3300009101 | Switchgrass Rhizosphere | MSVNNETLIARYLLGELPEEQQVEIEDRAFSDKDYLATITTVENDLIDEYV |
Ga0105243_104625543 | 3300009148 | Miscanthus Rhizosphere | MMSVDNEKLIAQYLLGELPEEQQVELEDRAFSDREYLASITAVENDLIDEYVRG |
Ga0105241_105001122 | 3300009174 | Corn Rhizosphere | MAVDLNNETLISQYLLGELSEEQQIEIEDLAFSDKKYLAGIAA |
Ga0105241_113092822 | 3300009174 | Corn Rhizosphere | MSVDNEKLISQYLLGELPEEQQVQIEDRAFSDKDYLAT |
Ga0105241_113468182 | 3300009174 | Corn Rhizosphere | MAVDLNNEKLISRYLLGELSEEQQVEIEDRAFADKEYLAS |
Ga0105241_122593712 | 3300009174 | Corn Rhizosphere | MAADIKNINNEKLIAQYLLGELTEEQQVEIEDRAFSDNDYLASI |
Ga0105241_124606722 | 3300009174 | Corn Rhizosphere | MAADFNNERLIARYLLGDLPEEQQVASEDRAFADKDYLALVTAVENDLIDEY |
Ga0105242_100122561 | 3300009176 | Miscanthus Rhizosphere | MATDLNSENLIARYLLGELSEEQQVEIEDRAFADQKYLASITTVEND |
Ga0105238_115801492 | 3300009551 | Corn Rhizosphere | MSVENETLIARYLLGELPEEQQVQIEDRAFSEKDYLATITAVE |
Ga0105249_125063442 | 3300009553 | Switchgrass Rhizosphere | MAVDLNNEKLISRYLLGELSEEQQVEIEDRAFADKEYL |
Ga0105249_125675342 | 3300009553 | Switchgrass Rhizosphere | MAAEFNNEKLIARYLLGDLPEEQQVEIEDRAFADKEYLALVTSVEN |
Ga0105249_131289832 | 3300009553 | Switchgrass Rhizosphere | MATDLMSEKLINRYLLGELPEEQQVEIEDRAFSDQEFMAIITAAENDLID |
Ga0105249_135353211 | 3300009553 | Switchgrass Rhizosphere | MSTDINNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLAGITAVENDL |
Ga0126304_108450151 | 3300010037 | Serpentine Soil | MAADLDNENIIARYLLGELPEEQQIEIEDRAFAEKEYLANITA |
Ga0126308_102510691 | 3300010040 | Serpentine Soil | MSVDNETLIARYLLGELPEEQQVEIEDRAFSDKNYLASI |
Ga0126308_111108872 | 3300010040 | Serpentine Soil | MSVDSEKLISRYLLGELPEEQQVEIEDRAFSDKDYLTSITAVENDLI |
Ga0126314_113454822 | 3300010042 | Serpentine Soil | MKDDSINEGLIVEYLLGDLPEEKQSEIEDRAFQDEQYLQNILAAESDLIDE |
Ga0126310_103573031 | 3300010044 | Serpentine Soil | MAAEPNSERVIARYLLGELPEEQQVEIEDRAFADKDYLASITA |
Ga0126311_111102602 | 3300010045 | Serpentine Soil | MAADLYSEQFIPGYLLGKLPEEQQVAIEDLAFRDEEYLANITAIENDLIDEYVRHELSDE |
Ga0126384_105353923 | 3300010046 | Tropical Forest Soil | MAADLNNEKLIARYLLGELPEEQQVAIEDRAFTDKDYLALVTAVENDLID |
Ga0126306_118702642 | 3300010166 | Serpentine Soil | MARRHAGELRKGFMAANLDNEKLIARYLLGELPEEQQIEVEDRAFADKEYFANIRAVEND |
Ga0134125_116602972 | 3300010371 | Terrestrial Soil | MSVENETLIARYLLGELPEEQQVQIEDRAFADKDYLATITAVENDLI |
Ga0105239_107507441 | 3300010375 | Corn Rhizosphere | MAADPNTEKLIAQYLLGELPEEQQVEIEDRAFQDKEYLDAITAVENDLIDEYVR |
Ga0134124_116140772 | 3300010397 | Terrestrial Soil | MAADFNNETLIARYLLGDLPEEQQVEIEDRAFADK |
Ga0134127_112070401 | 3300010399 | Terrestrial Soil | MVANPFSEKLIAQYLLGELPEEKHVEIEERAFGDAELMASITAVENELIDEYVRDEMPASDRV |
Ga0134127_112098982 | 3300010399 | Terrestrial Soil | MAANAISEKLISQYLLGELSEDQQVEIEDRAFADEEFMAGITAVENDLI |
Ga0134127_124762492 | 3300010399 | Terrestrial Soil | MSVDNEKLISRYLLGELPEEQQVEIEDRAFSDKDYL |
Ga0134127_126791101 | 3300010399 | Terrestrial Soil | MAADLNNEKLISRYLLGELSEEQQVEIEDRAFADKEYLASIT |
Ga0134123_113720882 | 3300010403 | Terrestrial Soil | MATDLNSENLIARYLLGELSEEQQVEIEDRAFADQKYLASIT |
Ga0105246_104026381 | 3300011119 | Miscanthus Rhizosphere | MATDLNSENLIARYLLGELSEEQQVAIEDRAFADQKYLASITS |
Ga0105246_117132511 | 3300011119 | Miscanthus Rhizosphere | MAANLNNETLIARYLLGELSEEQQVEIEDRAFSDKDYLASITAVENDLIDEYVRH |
Ga0105246_119274051 | 3300011119 | Miscanthus Rhizosphere | MAADLNNEKLIARYLLGDLPEEQQVAIEDRAFSDKEYLALVTAVEND |
Ga0157371_115582422 | 3300013102 | Corn Rhizosphere | MEMAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQDKEYLASITLVENDLIDEYVRGE |
Ga0157378_111614961 | 3300013297 | Miscanthus Rhizosphere | MATDLNSENLIARYLLGELSEEQQVEIEDRAFADQKYLASITAV |
Ga0157378_113766921 | 3300013297 | Miscanthus Rhizosphere | MSTDINNEKLISRYLLGELPEEQQVEIEDRAFADKDYLASITTVENDLIDEYVR |
Ga0163162_126246602 | 3300013306 | Switchgrass Rhizosphere | MSVDNEKLISQYLLGELPEEQQVEIEDRAFSDKDYLATITTVENDLID |
Ga0157375_110519462 | 3300013308 | Miscanthus Rhizosphere | MSVDNEKLISQYLLGELPEEQQVEIEDRAFCDKAYLATITTVENDLI |
Ga0157375_129699862 | 3300013308 | Miscanthus Rhizosphere | MEMAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQEK* |
Ga0163163_112086451 | 3300014325 | Switchgrass Rhizosphere | MATDLNSENLIARYLLGELSEEQQIEIEDRAFADQKYLASITAVENDLIDEY |
Ga0157380_112230151 | 3300014326 | Switchgrass Rhizosphere | MATDLNSENLIARYLLGELSEEQQVEIEDRAFADQKYLASITAVENDL |
Ga0157377_104760592 | 3300014745 | Miscanthus Rhizosphere | MSVDNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLATITT |
Ga0157379_126578442 | 3300014968 | Switchgrass Rhizosphere | MSTDINNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLAGITTVENDL |
Ga0190274_138451642 | 3300018476 | Soil | MSTNLNDEKLIAQYLLGELSEEQQVEIEDRAFADKEYFASITAVENDL |
Ga0207707_114842872 | 3300025912 | Corn Rhizosphere | MAANAISEKLISQYLLGELSEDQQVEIEDRAFADEEFMAGITA |
Ga0207662_101866063 | 3300025918 | Switchgrass Rhizosphere | MATDLMSEKLINRYLLGELPEEQQVEIEDRAFSDQEFMAIITAAEND |
Ga0207681_107976592 | 3300025923 | Switchgrass Rhizosphere | MEMAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQDKEYLASITSVENDLIDEYV |
Ga0207650_103167401 | 3300025925 | Switchgrass Rhizosphere | MASGRSPTEHMSANLNETLIARYLLGELSDDQQVEIEDRAFSDKEYLATITAVENDLIDEYV |
Ga0207659_115437331 | 3300025926 | Miscanthus Rhizosphere | MSVDNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLATITTVENDL |
Ga0207709_103770501 | 3300025935 | Miscanthus Rhizosphere | MATELNSEGVIARYLLGELSEEQQVEIEDRAFADQQYLAS |
Ga0207709_109316922 | 3300025935 | Miscanthus Rhizosphere | MMSVDNEKLIAQYLLGELPEEQQVELEDRAFSDREYLASITAVENDLI |
Ga0207670_119063362 | 3300025936 | Switchgrass Rhizosphere | MATDLMSEKLINRYLLGELPEEQQVEIEDRAFSDQEFMAIITA |
Ga0207704_119614502 | 3300025938 | Miscanthus Rhizosphere | MDVVADLNNEKLISRYLLGELSETEQVEIEDRAFADKEYLASVTAVENDLIDEY |
Ga0207703_101460933 | 3300026035 | Switchgrass Rhizosphere | MSVDNEKLISRYLLGELPEEQQVEIEDRAFSDKDYLA |
Ga0207703_103214561 | 3300026035 | Switchgrass Rhizosphere | MATDLNNETLIARYLLGELSEEQQVEIEDRAFEDQNYLASITA |
Ga0207703_110330652 | 3300026035 | Switchgrass Rhizosphere | MSVNNETLIARYLLGELPEEQQVEIEDRAFSDKDYLATITTVENDLIDEY |
Ga0207641_102846903 | 3300026088 | Switchgrass Rhizosphere | MTIDFNNETLIARYLLGELSEEQQIEIEDRAFADKEYLATITAVENDLIDEYVRHDL |
Ga0207676_101440981 | 3300026095 | Switchgrass Rhizosphere | MSVNNETLIARYLLGELPEEQQVEIEDRAFSDKDYLA |
Ga0207676_109002902 | 3300026095 | Switchgrass Rhizosphere | MAADLNNEKLISRYLLGELSEEQQVEIEDRAFTDKDY |
Ga0207676_120447831 | 3300026095 | Switchgrass Rhizosphere | MAANLNNETLIARYLLGELSEEQQVEIEDRAFSDKDYLASITAVENDLIDEYV |
Ga0207674_113107662 | 3300026116 | Corn Rhizosphere | MAVELNSENLITQYLLGQLTEEQQIEIEDRAFSDK |
Ga0207675_1019587431 | 3300026118 | Switchgrass Rhizosphere | MAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQDKEYLASITSVENDLIDEY |
Ga0209387_10485131 | 3300027639 | Agricultural Soil | MAAEPNSEKLIAQYLLGELGEEQQVEIEDRAFSDPEFLANITAVENDLIDEYVRE |
Ga0268264_100708441 | 3300028381 | Switchgrass Rhizosphere | MATDLNNETLIARYLLGELSEEQQVEIEDRAFEDQN |
Ga0268264_101191441 | 3300028381 | Switchgrass Rhizosphere | MATDLMSEKLINRYLLGELPEEQQVEIEDRAFSDQEFMA |
Ga0307413_103167891 | 3300031824 | Rhizosphere | MEMAANLNSEKILAQYLLGQLPEEQQVEIEDRAFQDKQYLASITSVENDLIDEYVRGEM |
Ga0307412_105088341 | 3300031911 | Rhizosphere | MATDLNNEKLISRYLLGELSEEQQVEIEDRAFVDKEYLASITAVENDLIDEY |
Ga0308173_109157032 | 3300032074 | Soil | MAADIKNINDEKLIAQYLLGELPEEQQVEIEDRAFSDKDYLA |
⦗Top⦘ |