NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101774

Metagenome / Metatranscriptome Family F101774

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101774
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 43 residues
Representative Sequence PDCPRTLDLLERSIHVDVSPLCDEQDLDEIAFAFEKVAKQVLA
Number of Associated Samples 97
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.96 %
% of genes near scaffold ends (potentially truncated) 95.10 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.725 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.098 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.85%    β-sheet: 0.00%    Coil/Unstructured: 59.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01408GFO_IDH_MocA 87.25
PF02894GFO_IDH_MocA_C 2.94
PF01041DegT_DnrJ_EryC1 1.96
PF02633Creatininase 0.98
PF00291PALP 0.98
PF07978NIPSNAP 0.98
PF13343SBP_bac_6 0.98
PF16657Malt_amylase_C 0.98
PF00528BPD_transp_1 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 2.94
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 1.96
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 1.96
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 1.96
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 1.96
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 1.96
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 1.96
COG1402Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)Coenzyme transport and metabolism [H] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_10873534All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300000956|JGI10216J12902_103853434All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300001305|C688J14111_10232414All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300004019|Ga0055439_10001793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4242Open in IMG/M
3300004479|Ga0062595_100216803All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300005161|Ga0066807_1039387All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005178|Ga0066688_10885844All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005187|Ga0066675_10640541All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300005335|Ga0070666_11115644All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005337|Ga0070682_100003808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. 49Tsu3.1M38384Open in IMG/M
3300005435|Ga0070714_101675063All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005447|Ga0066689_10814451All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005468|Ga0070707_100397684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1338Open in IMG/M
3300005539|Ga0068853_100964991All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300005540|Ga0066697_10610968All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005543|Ga0070672_100493656All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300005556|Ga0066707_10924907All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005561|Ga0066699_11273286All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005578|Ga0068854_100688985All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300005764|Ga0066903_100962345All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300006058|Ga0075432_10369539All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006173|Ga0070716_100058445All Organisms → cellular organisms → Bacteria2219Open in IMG/M
3300006575|Ga0074053_11891562All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006581|Ga0074048_12680859All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006794|Ga0066658_10218963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1012Open in IMG/M
3300006854|Ga0075425_101798468All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300009012|Ga0066710_100540888All Organisms → cellular organisms → Bacteria1761Open in IMG/M
3300009094|Ga0111539_11130654All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300009137|Ga0066709_102486779All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300009147|Ga0114129_13237457All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009156|Ga0111538_11841253All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300009176|Ga0105242_11808016All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300009545|Ga0105237_10228249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1862Open in IMG/M
3300009545|Ga0105237_11776216All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300009545|Ga0105237_12482701All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009553|Ga0105249_10026795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ok9095198Open in IMG/M
3300010301|Ga0134070_10290560All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300010303|Ga0134082_10386040All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300010366|Ga0126379_12230526All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010373|Ga0134128_11512400All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300010375|Ga0105239_10407498All Organisms → cellular organisms → Bacteria1539Open in IMG/M
3300010375|Ga0105239_10951885All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300010396|Ga0134126_11547622All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300010398|Ga0126383_12375195All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300012011|Ga0120152_1066974All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300012198|Ga0137364_10247266All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300012198|Ga0137364_11298396All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012206|Ga0137380_11513589All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300012208|Ga0137376_11755381All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012210|Ga0137378_11093138All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300012211|Ga0137377_10288061All Organisms → cellular organisms → Bacteria → Proteobacteria1576Open in IMG/M
3300012355|Ga0137369_10075852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2832Open in IMG/M
3300012359|Ga0137385_11461470All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300012361|Ga0137360_11470308All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300012582|Ga0137358_11077030All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012927|Ga0137416_10912071All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012930|Ga0137407_11954439All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300012951|Ga0164300_10401992All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300012955|Ga0164298_10047033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2050Open in IMG/M
3300012957|Ga0164303_10169381All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300012958|Ga0164299_10219041All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300012971|Ga0126369_10970752All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300012989|Ga0164305_11983581All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300014745|Ga0157377_10015713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter3879Open in IMG/M
3300014829|Ga0120104_1046947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium809Open in IMG/M
3300014969|Ga0157376_12086957All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300015054|Ga0137420_1479522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6978Open in IMG/M
3300015265|Ga0182005_1113636All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300015374|Ga0132255_105260073All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300016404|Ga0182037_11913023All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300018029|Ga0187787_10450940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300018433|Ga0066667_11444730All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300019866|Ga0193756_1044151All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300025538|Ga0210132_1002276All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300025908|Ga0207643_10838207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300025913|Ga0207695_10678565All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300025917|Ga0207660_10190783All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300025932|Ga0207690_10073772All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300025937|Ga0207669_11146010All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300025960|Ga0207651_11445461All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300026041|Ga0207639_11180450All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300026041|Ga0207639_11985846All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300027882|Ga0209590_10259529All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300028674|Ga0302161_10210176All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300028715|Ga0307313_10213323All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300028743|Ga0302262_10269144All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300028755|Ga0307316_10115919All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300028787|Ga0307323_10327054All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028819|Ga0307296_10606020All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300028878|Ga0307278_10458690All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300030336|Ga0247826_11388826All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031460|Ga0272430_1178057All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300031740|Ga0307468_100688013All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300031996|Ga0308176_12967229All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300032001|Ga0306922_11203776All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300032010|Ga0318569_10469552All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300032173|Ga0315268_11571019All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300032261|Ga0306920_103860167All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300032397|Ga0315287_12570552All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300032401|Ga0315275_12507697All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300032828|Ga0335080_11727363All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300032893|Ga0335069_11846823All Organisms → cellular organisms → Bacteria641Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028674Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031460Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nordEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1087353413300000891SoilLERSIHVDVSPLCEEQDLDEIGFAFEKVAKQVLA*
JGI10216J12902_10385343413300000956SoilLERSIHVDLSPCNDEQDLDQIGFAFEKVAHGVLEPG*
C688J14111_1023241413300001305SoilPAPECPRTLALLARSIHVDVSPLCDEHDLDEIAFAFEKVARVILA*
Ga0055439_1000179373300004019Natural And Restored WetlandsAEAGLPAPDCPRTLDLTSRAIHVDVSPLNEAQDLQEIALAFTKVASSVLS*
Ga0062595_10021680313300004479SoilTQPDCPRTLELLERSIHVDVSPLCDEQDIDEIAFAFEKVAKQVLA*
Ga0066807_103938723300005161SoilDCPRTLDLLERAVHLDVSPLDDGEDLTEIELALTKVATQVLG*
Ga0066688_1088584413300005178SoilPRPECPHTLDLLERAVHIDVSPLCDEQDLDEIALAFRKVATRVLA*
Ga0066675_1064054123300005187SoilCPRTLALLERSVHIDVSPLCDEQDLDEIAFSFEKVARVILA*
Ga0070666_1111564423300005335Switchgrass RhizosphereSGGTAPECPRTLELVERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA*
Ga0070682_10000380813300005337Corn RhizospherePRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA*
Ga0070714_10167506313300005435Agricultural SoilPDCPQTLGLLERTIHVDLSPLLDEQDVDEIALAFEKVARGILA*
Ga0066689_1081445123300005447SoilAGAPLPDCPRTLDLLERTIHVDVSPLCEEQDLEEIALAFRKVATRVLA*
Ga0070707_10039768413300005468Corn, Switchgrass And Miscanthus RhizosphereRTLALLERAIHVDVSSLCDEQDLDEIAFAFAKVAHGILEPA*
Ga0068853_10096499123300005539Corn RhizospherePRTLDLLERSIHVDLSPLLDEQDIDELALAFEKVARGILA*
Ga0066697_1061096823300005540SoilECPRTLDLLERAIHVDVSPLCDEHDLDEIALAFRKVSSQILA*
Ga0070672_10049365623300005543Miscanthus RhizospherePDCPRTLDLVERAIHVDVSPLCEERDLDEIAFAFEKVAKQVLA*
Ga0066707_1092490713300005556SoilAPDCPRTLELLERSIHVDVSPLCDEQDLEEIAFAFEKVAKQVLA*
Ga0066699_1127328623300005561SoilTLDLLGRAIHVDVSPLLEEQDLEEIALAFRKVANAILA*
Ga0068854_10068898513300005578Corn RhizosphereLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA*
Ga0066903_10096234533300005764Tropical Forest SoilCPRTLELLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLESS*
Ga0075432_1036953923300006058Populus RhizosphereSGRPQPDCPRTLALLERSIHVDLSPLNDEQDLEEIGFAFEKVAHAVLGAA*
Ga0070716_10005844513300006173Corn, Switchgrass And Miscanthus RhizosphereSGGAAPECPRTLELLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA*
Ga0074053_1189156223300006575SoilRTLELLERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA*
Ga0074048_1268085923300006581SoilGNPAPDCPRTLELTGRAIHVDLSPLCDEQDLDEIALAFEKVAHAVLA*
Ga0066658_1021896313300006794SoilDLLERAVHIDVSPLCDEQDLDEIALAFRKVATRVLA*
Ga0075425_10179846813300006854Populus RhizosphereDCPRTLALLERSIHVDLSPLNDEQDLEEIGFAFEKVAHAVLGAA*
Ga0066710_10054088813300009012Grasslands SoilAAGRPAPDCPRTLDLLERAIHVDVSPLCVGQDLEEIALAFRKVSDQVLS
Ga0111539_1113065423300009094Populus RhizospherePRTLGLLERSIHVDLSPLNDEHDLDEIGFAFEKVAHGVLEPG*
Ga0066709_10248677913300009137Grasslands SoilLLERSIHIDVSPLCDEQDLDEIAFAFEKVARVILA*
Ga0114129_1323745713300009147Populus RhizospherePDCPRTLDLLERSIHVDVSPLCDEQDLDEIAFAFEKVAKQVLA*
Ga0111538_1184125313300009156Populus RhizosphereLGTQPDCPRTLELLERSIHVDVSPLCDEQDIDEIAFAFEKVAKQVLA*
Ga0105242_1180801623300009176Miscanthus RhizosphereALWAADADAPDCPRTLELRERSIHVDVSPLCEEQDLEEIAFAFEKVAKQVLT*
Ga0105237_1022824913300009545Corn RhizosphereCPRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA*
Ga0105237_1177621613300009545Corn RhizosphereAAGRPSPHCPQTLALVERAIHVDLSPLCDEQDLDEIAFAFEKVARGILA*
Ga0105237_1248270123300009545Corn RhizosphereTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA*
Ga0105249_1002679513300009553Switchgrass RhizosphereRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA*
Ga0134070_1029056023300010301Grasslands SoilLLERSIHIDVSPLCEERDLDEIAFAFEKVAKQVLA*
Ga0134082_1038604013300010303Grasslands SoilLDLLERAVHIDVSPLCDEQDLDEIALAFRKVATRVLA*
Ga0126379_1223052623300010366Tropical Forest SoilELLERTIHVDLPPLNDEQDLDEIAFAFEKVADGVLGTA*
Ga0134128_1151240013300010373Terrestrial SoilERPDCPRTLDLVERAIHVDVSPLCEERDLDEIAFAFEKVAKQVLV*
Ga0105239_1040749813300010375Corn RhizosphereKGEPAPDCPRTLELLERTIHVDLSPLLEDADVDELALAFEKVARGILA*
Ga0105239_1095188523300010375Corn RhizospherePDCHRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA*
Ga0134126_1154762223300010396Terrestrial SoilCPRTLELLERSIHIDVSPLCEEQDLNEISFAFEKVAKQVLA*
Ga0126383_1237519513300010398Tropical Forest SoilEAAGAPAPDCPQTLALLERAIHVDVSPLCDERDLDEIALAWRKVATQVLV*
Ga0120152_106697413300012011PermafrostPDCPRTLDLLARTIHVDLSPLNDEQDLDEIAFAFEKVARGVLGTEA*
Ga0137364_1024726623300012198Vadose Zone SoilIEADGRPAPDCPRTVELLERTIHVDVSPLCEEQDLDEIAFAFEKVAKQVLV*
Ga0137364_1129839613300012198Vadose Zone SoilTLDLLERTVHIDVSPLCDAQDLDEIALAFRKVATQVLA*
Ga0137380_1151358923300012206Vadose Zone SoilLDLLERAVHIDVSPLCDQQDLDEIALAFRKVATRVLA*
Ga0137376_1175538113300012208Vadose Zone SoilTLELLERTIHIDLSPLCDEQDLDEIAFAFEKVANAILA*
Ga0137378_1109313813300012210Vadose Zone SoilAAGADRPDCPRTLELLERTIHVDVSPLCEDQDLHEIAFAFEKVAKQVLA*
Ga0137377_1028806133300012211Vadose Zone SoilDCPRTLELLERTIHVDVSPLCSEQDLDEIAFAFEKVAKQVLA*
Ga0137369_1007585253300012355Vadose Zone SoilAAGTPAPDCPRTLELLARTVHVDVAPQLDEQDLDEICLALTKVATQVLG*
Ga0137385_1146147023300012359Vadose Zone SoilGAARPDCPRTLELLERTIHVDVSPLCEEQDLEEIAFAFEKVAKQVLA*
Ga0137360_1147030823300012361Vadose Zone SoilRPDCPRTLDLLERAVHIDVSPLCDQQDLDEIALAFRKVATRVLA*
Ga0137358_1107703023300012582Vadose Zone SoilQPPPDCPRTLALLERSIHVDLSPLNDEQDLNEIAFAFEKVAHGVLEAA*
Ga0137416_1091207123300012927Vadose Zone SoilDCPRTLELLERTIHVDVSPLCDEQDLDEIAFAFEKVAKQVLA*
Ga0137407_1195443923300012930Vadose Zone SoilDCPRTLELLERTIHVDVSPLCEEQDLHEIAFAFEKVVKQVLA*
Ga0164300_1040199223300012951SoilLLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLT*
Ga0164298_1004703323300012955SoilLLERSIHVDVSPLCEEQDLDETAFAFEKVAKQVLT*
Ga0164303_1016938123300012957SoilLLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA*
Ga0164299_1021904123300012958SoilASGGAAPECPRTLELLERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA*
Ga0126369_1097075213300012971Tropical Forest SoilPDCPQTLGLLERSIHIDVSPLCDEHDLGEIAFAFEKVARVILA*
Ga0164305_1198358113300012989SoilPGPDCPRTLELLERSIHVDISPLCDDQDLDEIAFAFEKVAKRVLA*
Ga0157377_1001571313300014745Miscanthus RhizosphereRPDCPRTLDLVERAIHVDVSPLCEERDLDEIAFAFEKVAKQVLA*
Ga0120104_104694713300014829PermafrostLDLLERAIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA*
Ga0157376_1208695723300014969Miscanthus RhizospherePPDCPRTLALLERSIHVDVSPLCDETDLDEIALAFEKVAHGILAG*
Ga0137420_147952283300015054Vadose Zone SoilMAAGADRPDCPRTLELLERTIHVDASPLCDEQDLDEIAFAFEKVAKQVLA*
Ga0182005_111363613300015265RhizosphereLLERTIHVDLSPLLEEADVDEVALAFEKVARGILA*
Ga0132255_10526007323300015374Arabidopsis RhizosphereDCPRTLALLERSIHVDLSPCNDEQDLDEIGFAYEKVAHGVLEPG*
Ga0182037_1191302313300016404SoilELLERTIHVDLSPLNDEQDLDEIAFAFEKVAAGVL
Ga0187787_1045094023300018029Tropical PeatlandAGRSAPDCPRTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVASGVLRAA
Ga0066667_1144473023300018433Grasslands SoilCPRTLALLERSVHIDVSPLCDEQDLDEIAFAFEKVARVILA
Ga0193756_104415123300019866SoilPECPRTLGLLERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA
Ga0210132_100227633300025538Natural And Restored WetlandsIAEAGLPAPDCPRTLDLTSRAIHVDVSPLNEAQDLQEIALAFTKVASSVLS
Ga0207643_1083820713300025908Miscanthus RhizosphereLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA
Ga0207695_1067856523300025913Corn RhizosphereLELLERTIHVDLSPLLEDADVDELALAFEKVARGILA
Ga0207660_1019078333300025917Corn RhizospherePRTLDLLERTIHVDLSPLLEEDDVDELALAFEKVARGILA
Ga0207690_1007377213300025932Corn RhizosphereKAKGEPAPDCPRTLELLERTIHVDLSPLLEDADVDELALAFEKVARGILA
Ga0207669_1114601013300025937Miscanthus RhizosphereGTAPECPRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA
Ga0207651_1144546123300025960Switchgrass RhizosphereDADAPDCPRTLELLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA
Ga0207639_1118045013300026041Corn RhizosphereECPRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA
Ga0207639_1198584623300026041Corn RhizosphereDAVGADAPDCPRTLDLLERSIHVDLSPLLDEQDIDELALAFEKVARGILA
Ga0209590_1025952923300027882Vadose Zone SoilEAGHPSPDCPRTLGLLERTIHVDVSPLCDEQDIDEIGFAFEKVAQGILGRT
Ga0302161_1021017613300028674FenAGNPAPNCPRTLDLVGRAIHIDLSPLCDEQDLQELALAFTKVATAVLA
Ga0307313_1021332313300028715SoilDCPRTLDLVERAIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA
Ga0302262_1026914423300028743FenLDLVGRAIHIDLSPLCDEQDLQELALAFTKVATAVLA
Ga0307316_1011591923300028755SoilELLERSIHVDVSPLCEEQDLNEIAFAFEKVAKQVFA
Ga0307323_1032705413300028787SoilQPDCPRTLELLARAIHIDLSPLCDEQDLEEIAFAFEKVANGILA
Ga0307296_1060602023300028819SoilEADGRPAPDCPHTLELLERSIHIDVSPLCEERDLEEIAFAFEKVAKQVLA
Ga0307278_1045869013300028878SoilPPDCPRTLDLVERAIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA
Ga0247826_1138882623300030336SoilLALLQRTIHVDLSPLNDEQDLDELGLAFEKVAHGVLEPA
Ga0272430_117805723300031460RockTLDLLGRAAHIDVSPLLTDQDVQETILAIHKVAEAIL
Ga0307468_10068801323300031740Hardwood Forest SoilPRTLDLLERSIHVDISPLCDEQDLGEIAFAFEKVAKQVLA
Ga0308176_1296722923300031996SoilAYLKDRGAPAPDCPRTLGLLERTIHVDLSPLLEEADVDELALAFEKVARGILA
Ga0306922_1120377623300032001SoilRTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLEVA
Ga0318569_1046955213300032010SoilAPDCPRTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVL
Ga0315268_1157101923300032173SedimentGNPAPECPRTLALLSRTIHVDLSPLCDEQDLDEIALAFEKVARAVLA
Ga0306920_10386016713300032261SoilRPAPECPRTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLEVA
Ga0315287_1257055213300032397SedimentIDASGHDAPNRPRTLGLLERSIHVDVSPLCDDDDIDEIAFAFEKVAAAVVS
Ga0315275_1250769723300032401SedimentRPRTLDLLERSIHVDVSPLSDDDDIDEIAFAFEKVAAAVVS
Ga0335080_1172736323300032828SoilRTLELLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLEAA
Ga0335069_1184682313300032893SoilLERSIHIDLSPLNDEQDLDEIAFAFEKVAAGVLEVAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.