NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101655

Metagenome Family F101655

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101655
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence IARGTLPEAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL
Number of Associated Samples 95
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.06 %
% of genes from short scaffolds (< 2000 bps) 84.31 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.451 % of family members)
Environment Ontology (ENVO) Unclassified
(29.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.157 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.30%    β-sheet: 0.00%    Coil/Unstructured: 50.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF03739LptF_LptG 93.14
PF04828GFA 3.92
PF02146SIR2 0.98
PF05299Peptidase_M61 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0795Lipopolysaccharide export LptBFGC system, permease protein LptFCell wall/membrane/envelope biogenesis [M] 93.14
COG3791Uncharacterized conserved proteinFunction unknown [S] 3.92
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.98
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.98
COG3975Predicted metalloprotease, contains C-terminal PDZ domainGeneral function prediction only [R] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004635|Ga0062388_102934328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria503Open in IMG/M
3300005334|Ga0068869_101670943All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria568Open in IMG/M
3300005459|Ga0068867_100803262All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales839Open in IMG/M
3300005538|Ga0070731_10609868All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300005541|Ga0070733_10279123All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1102Open in IMG/M
3300005591|Ga0070761_10590554All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria690Open in IMG/M
3300005712|Ga0070764_10117195All Organisms → cellular organisms → Bacteria → Proteobacteria1438Open in IMG/M
3300005993|Ga0080027_10467328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria511Open in IMG/M
3300006175|Ga0070712_100111334All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2044Open in IMG/M
3300006176|Ga0070765_101131842All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria739Open in IMG/M
3300007788|Ga0099795_10039969All Organisms → cellular organisms → Bacteria → Proteobacteria1664Open in IMG/M
3300009545|Ga0105237_12020083All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300009551|Ga0105238_10237779All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1799Open in IMG/M
3300009826|Ga0123355_10989313All Organisms → cellular organisms → Bacteria → Proteobacteria895Open in IMG/M
3300010043|Ga0126380_10855176All Organisms → cellular organisms → Bacteria → Proteobacteria750Open in IMG/M
3300010046|Ga0126384_10318406All Organisms → cellular organisms → Bacteria → Proteobacteria1285Open in IMG/M
3300010048|Ga0126373_12611371All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300010049|Ga0123356_14079864All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300010303|Ga0134082_10091369All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1199Open in IMG/M
3300010361|Ga0126378_10992212All Organisms → cellular organisms → Bacteria → Proteobacteria944Open in IMG/M
3300010376|Ga0126381_102626259All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300012189|Ga0137388_11134213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria719Open in IMG/M
3300012205|Ga0137362_10137328All Organisms → cellular organisms → Bacteria → Proteobacteria2083Open in IMG/M
3300012362|Ga0137361_10070184All Organisms → cellular organisms → Bacteria → Proteobacteria2965Open in IMG/M
3300012362|Ga0137361_10522591All Organisms → cellular organisms → Bacteria → Proteobacteria1090Open in IMG/M
3300012582|Ga0137358_10326094All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales1041Open in IMG/M
3300012918|Ga0137396_10063293All Organisms → cellular organisms → Bacteria2569Open in IMG/M
3300012924|Ga0137413_11417769All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300012971|Ga0126369_12146407All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300016341|Ga0182035_11656772All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300016422|Ga0182039_10080560All Organisms → cellular organisms → Bacteria → Proteobacteria2338Open in IMG/M
3300016445|Ga0182038_11566512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium592Open in IMG/M
3300017924|Ga0187820_1066783All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria994Open in IMG/M
3300017973|Ga0187780_10439578All Organisms → cellular organisms → Bacteria → Proteobacteria928Open in IMG/M
3300017993|Ga0187823_10340941All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300018058|Ga0187766_11268747All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium536Open in IMG/M
3300018085|Ga0187772_10017164All Organisms → cellular organisms → Bacteria → Proteobacteria4091Open in IMG/M
3300018086|Ga0187769_10374625All Organisms → cellular organisms → Bacteria → Proteobacteria1069Open in IMG/M
3300019866|Ga0193756_1000185All Organisms → cellular organisms → Bacteria → Proteobacteria4402Open in IMG/M
3300020022|Ga0193733_1143216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium650Open in IMG/M
3300020581|Ga0210399_11263646All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300021086|Ga0179596_10311767All Organisms → cellular organisms → Bacteria → Proteobacteria786Open in IMG/M
3300021168|Ga0210406_10337995All Organisms → cellular organisms → Bacteria → Proteobacteria1217Open in IMG/M
3300021372|Ga0213877_10221752All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300021406|Ga0210386_10333603All Organisms → cellular organisms → Bacteria → Proteobacteria1303Open in IMG/M
3300021432|Ga0210384_10380979All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1270Open in IMG/M
3300021432|Ga0210384_11229462All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300021439|Ga0213879_10203032All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300021477|Ga0210398_11122875All Organisms → cellular organisms → Bacteria → Proteobacteria623Open in IMG/M
3300021477|Ga0210398_11323348All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300023259|Ga0224551_1008007All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1760Open in IMG/M
3300025898|Ga0207692_10067726All Organisms → cellular organisms → Bacteria → Proteobacteria1870Open in IMG/M
3300025903|Ga0207680_11234239All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.533Open in IMG/M
3300025906|Ga0207699_10229183All Organisms → cellular organisms → Bacteria → Proteobacteria1272Open in IMG/M
3300025906|Ga0207699_10324797All Organisms → cellular organisms → Bacteria → Proteobacteria1080Open in IMG/M
3300025929|Ga0207664_10612487All Organisms → cellular organisms → Bacteria → Proteobacteria978Open in IMG/M
3300025949|Ga0207667_11963817All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300026281|Ga0209863_10048813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales1259Open in IMG/M
3300027505|Ga0209218_1142054All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300027548|Ga0209523_1024057All Organisms → cellular organisms → Bacteria → Proteobacteria1201Open in IMG/M
3300027648|Ga0209420_1156651All Organisms → cellular organisms → Bacteria → Proteobacteria622Open in IMG/M
3300027725|Ga0209178_1436899All Organisms → cellular organisms → Bacteria → Proteobacteria502Open in IMG/M
3300027855|Ga0209693_10273237All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300027874|Ga0209465_10479936All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300027965|Ga0209062_1136306All Organisms → cellular organisms → Bacteria → Proteobacteria970Open in IMG/M
3300029943|Ga0311340_11009377All Organisms → cellular organisms → Bacteria → Proteobacteria683Open in IMG/M
3300031543|Ga0318516_10838663All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300031544|Ga0318534_10064711All Organisms → cellular organisms → Bacteria → Proteobacteria2063Open in IMG/M
3300031564|Ga0318573_10025950All Organisms → cellular organisms → Bacteria → Proteobacteria2693Open in IMG/M
3300031682|Ga0318560_10771622All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300031720|Ga0307469_10033600All Organisms → cellular organisms → Bacteria3015Open in IMG/M
3300031724|Ga0318500_10496035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria613Open in IMG/M
3300031736|Ga0318501_10020413All Organisms → cellular organisms → Bacteria → Proteobacteria2776Open in IMG/M
3300031740|Ga0307468_100692297All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria850Open in IMG/M
3300031744|Ga0306918_10513916All Organisms → cellular organisms → Bacteria → Proteobacteria938Open in IMG/M
3300031747|Ga0318502_10910312All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300031753|Ga0307477_10535093All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300031764|Ga0318535_10114679All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae1187Open in IMG/M
3300031771|Ga0318546_11109609All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria556Open in IMG/M
3300031781|Ga0318547_10392103All Organisms → cellular organisms → Bacteria → Proteobacteria851Open in IMG/M
3300031819|Ga0318568_10030622All Organisms → cellular organisms → Bacteria → Proteobacteria3000Open in IMG/M
3300031819|Ga0318568_10946634All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300031823|Ga0307478_10189344All Organisms → cellular organisms → Bacteria → Proteobacteria1651Open in IMG/M
3300031859|Ga0318527_10127026All Organisms → cellular organisms → Bacteria → Proteobacteria1060Open in IMG/M
3300031890|Ga0306925_12166858All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300031941|Ga0310912_11376402All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300031942|Ga0310916_10375738All Organisms → cellular organisms → Bacteria → Proteobacteria1208Open in IMG/M
3300031946|Ga0310910_10571739All Organisms → cellular organisms → Bacteria → Proteobacteria896Open in IMG/M
3300031954|Ga0306926_10873713All Organisms → cellular organisms → Bacteria → Proteobacteria1079Open in IMG/M
3300031954|Ga0306926_12436117All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300032035|Ga0310911_10281739All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria955Open in IMG/M
3300032044|Ga0318558_10583900All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales558Open in IMG/M
3300032054|Ga0318570_10024893All Organisms → cellular organisms → Bacteria → Proteobacteria2316Open in IMG/M
3300032065|Ga0318513_10017974All Organisms → cellular organisms → Bacteria → Proteobacteria2909Open in IMG/M
3300032180|Ga0307471_100736274All Organisms → cellular organisms → Bacteria → Proteobacteria1151Open in IMG/M
3300032205|Ga0307472_101642333All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium633Open in IMG/M
3300032261|Ga0306920_100397795All Organisms → cellular organisms → Bacteria → Proteobacteria2048Open in IMG/M
3300032261|Ga0306920_101853940All Organisms → cellular organisms → Bacteria → Proteobacteria849Open in IMG/M
3300032892|Ga0335081_10258467All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2344Open in IMG/M
3300033134|Ga0335073_11486843All Organisms → cellular organisms → Bacteria → Proteobacteria655Open in IMG/M
3300033289|Ga0310914_10281349All Organisms → cellular organisms → Bacteria → Proteobacteria1498Open in IMG/M
3300033807|Ga0314866_003593All Organisms → cellular organisms → Bacteria → Proteobacteria1742Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.96%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.98%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062388_10293432823300004635Bog Forest SoilQLISVGKVLIARGALPQFLGLWWTHAFVVLFALLVIFGPGVAHRLRYRWQGL*
Ga0068869_10167094313300005334Miscanthus RhizosphereLLYTQLISVGKVWIAHGTLPGFLGLWWTHAAVVLLALLVILGPRFANRLRYRVRGL*
Ga0068867_10080326223300005459Miscanthus RhizosphereVGKVWIAHGTLPGFLGLWWTHAAVVLLALLVILGPRFANRLRYRVRGL*
Ga0070731_1060986823300005538Surface SoilSVPAFLGLWWTHVVVIGFGLLVWLGPRLATRLRYRLRGL*
Ga0070733_1027912313300005541Surface SoilGKTWIARGTVPESFGLWWTHAVVALLACAVIFGPRLRTLLHYRWRRL*
Ga0070761_1059055413300005591SoilYFLYQNLITVGKVWISRGTVPEVAGLWWTHAAVVLLALTVILGPTVATRVRYRVRGL*
Ga0070764_1011719533300005712SoilGTLPPFLGLWWTHAVVVALALLVIFGPTFANRLRYRVRGL*
Ga0080027_1046732823300005993Prmafrost SoilGKVWIARGTAPYYLGLWWTHAVVIIIALAVILGPGYVNRLRYRMRGL*
Ga0070712_10011133413300006175Corn, Switchgrass And Miscanthus RhizosphereYYNLATTGKTWIARGTVPEVVGLWWTHVVVALLALGVILAPGLINRLRYRMRGL*
Ga0070765_10113184213300006176SoilYSQLISVGKVLLGRDTLPLFLGLWWTHAVVVALALLVIFGPTLANRLRYRVRGL*
Ga0099795_1003996933300007788Vadose Zone SoilGKVWIARGTIPEFLGLWWTHAAVVLLALMVIVGPGLGNRLRYRMRGL*
Ga0105237_1202008323300009545Corn RhizosphereVGLWWTHAAVVLLALLVIWGPTLSTRLRYRIRGL*
Ga0105238_1023777913300009551Corn RhizosphereNLITVGKSWIARGKVPEFVGLWWTHAAVALLALFVVMGPTVANRIRYRVRGL*
Ga0123355_1098931313300009826Termite GutPEVVGLWWTHVAVVLLALLVIFGPGLVNRLRYRRRRQ*
Ga0126380_1085517623300010043Tropical Forest SoilEVVGLWWTHVVVALLALAVIVAPGLINRLRYRLRYGTRGL*
Ga0126384_1031840623300010046Tropical Forest SoilVYYNLATTGRTWIAHGKLPEVVGLWWTHVVVALLALAVIVGPGIANRVRYRMRGL*
Ga0126373_1261137123300010048Tropical Forest SoilPEVVGLWWTHVVVALLALGVIVGPGLIHRLRYRMRHR*
Ga0123356_1407986423300010049Termite GutGTVPPVVGLWWTHVVVALLALLVIVGPGLLNRLRYRLRGL*
Ga0134082_1009136923300010303Grasslands SoilVIFFLYVNLISVGKVWIARGTIPEFLGLWWTHAAVVLLALMVIVGPGLSNRLRYRVRGL*
Ga0126378_1099221213300010361Tropical Forest SoilIFFVYYNLATTGRTWIAHGKLPEVVGLWWTHVVVALLAVAVIVGPGIANRVRYRMRGL*
Ga0126381_10262625913300010376Tropical Forest SoilGTLPEVVGLWWTHLVVALLALAVILGPGIATRLRYRMRSP*
Ga0137388_1113421323300012189Vadose Zone SoilFLYVNLISVGKVWIARATIPEFLGLWWTHAAVVLLALMVIVGPGLSNRLRYRVRGL*
Ga0137362_1013732843300012205Vadose Zone SoilVNLISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRVRGL*
Ga0137361_1007018413300012362Vadose Zone SoilISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLANRLRYRVRGL*
Ga0137361_1052259123300012362Vadose Zone SoilKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRMRGL*
Ga0137358_1032609423300012582Vadose Zone SoilVGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRVRGL*
Ga0137396_1006329343300012918Vadose Zone SoilARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRMRGL*
Ga0137413_1141776923300012924Vadose Zone SoilRGTVPEALGLWWTHAAVVLLALAVIAGPGLATRLRYRIRGL*
Ga0126369_1214640713300012971Tropical Forest SoilIWLARGSVPSPLGLWWTHLVVIALALLVILGPTLANRLRYRWQGL*
Ga0182035_1165677223300016341SoilATTGKTWIARGTLPEAVGLWWTHAVVALLALLVILGPGLVNRLRYRMRGL
Ga0182039_1008056043300016422SoilIARGTLPEAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL
Ga0182038_1156651213300016445SoilNLAAAGKTGIARGRLPELVGLWWTHIAVTLLALLVIAGPRLTYRLRYRMRNP
Ga0187820_106678323300017924Freshwater SedimentIAVVIFFLYYALASAGKTWIARGTAPELLGLWWTHAVVLVLALAVIMGPRLAERVRYRVRGL
Ga0187780_1043957823300017973Tropical PeatlandGTLPEVVGLWWTHVVVALLALAVILGPGIANRVRYRMRGL
Ga0187823_1034094113300017993Freshwater SedimentKVWIARGTVPATLGLWWTHAVVLLLALVVLVGPGLSTRLRYRFQRL
Ga0187766_1126874713300018058Tropical PeatlandARGTIPEAAGLWWTHVIVVLFALIIIASPGLAQRLRYRMRGP
Ga0187772_1001716453300018085Tropical PeatlandVSLGLWWTHAVVGLLALAIIVGPGLMNRLRYRVRRL
Ga0187769_1037462513300018086Tropical PeatlandRGTLPESLGLWWTHAVVALLALAVILTPKILQRLRYRVRGL
Ga0193756_100018553300019866SoilIFFLYVNLISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVMVGPGLGNRLRYRVRGL
Ga0193733_114321613300020022SoilIARGTIPEFLGLWWTHAAVVLLALMVIVGPGLRNRLRYRVRGL
Ga0210399_1126364613300020581SoilARGTVPVALGLWWTHAAVVLLALAVIVGPGLVNRLRYRVRRL
Ga0179596_1031176723300021086Vadose Zone SoilTVGKVWISRGTLPEIAGLWWTHAAVLLLALVVILGPALGTRLRYRARGL
Ga0210406_1033799513300021168SoilIAGLWWTHAAVLLLALVVILGPTLGTRLRYRIRGL
Ga0213877_1022175213300021372Bulk SoilLPEALGLWWTHAAVALLALGVILGPGVAHRLRHRMRAS
Ga0210386_1033360333300021406SoilRGSVPEIAGLWWTHAAVILLAFAVISGPNIATRFRYRVRGL
Ga0210384_1038097913300021432SoilYLNLVSAGKVWIGRGTVPVVLGLWWTHAAVVLLALAVILGPGLANRLRYRVRRL
Ga0210384_1122946213300021432SoilPQVLGLWWTHAVVVALALLIILGPGLRNRMRYRMRGL
Ga0213879_1020303213300021439Bulk SoilVPEAIGLWWTHVLVALLALAVILGPGLLNRLRYRLRGL
Ga0210398_1112287523300021477SoilLISVGKVWIARGTLPLFLGLWWTHAVVVLIALMVIFGPVLAQRLRYRWAGL
Ga0210398_1132334813300021477SoilTVPAEFGLWWTHAVVVLLAGAVIFAPGLRVRLRYRRTAT
Ga0224551_100800713300023259SoilVPEVLGLWWAHGAVVLLALAVIYAPGRLARLRNKSPA
Ga0207692_1006772633300025898Corn, Switchgrass And Miscanthus RhizosphereVRSALISVGKVMIAHGKAPQVLGLWWTHAVVVALALLIILGPGLRSRLRYRMRGL
Ga0207680_1123423923300025903Switchgrass RhizosphereVVIYFLYQNLINIGKTWIARGKLPEIAGLWWTHAAVALLALVVIYGPVLSHWIRYRIRGL
Ga0207699_1022918323300025906Corn, Switchgrass And Miscanthus RhizosphereWISRGAVPEVVGLWWTHAAVVLLALLVISGPTLANRIRYRLRGL
Ga0207699_1032479713300025906Corn, Switchgrass And Miscanthus RhizosphereLARGSVPEVVGLWWTHVVVALLALAVILGPGIATRLRYRWRGS
Ga0207664_1061248713300025929Agricultural SoilVPAAVGLWWTHVVVVLLTLAVVLGPTSLQRLRYRTART
Ga0207667_1196381713300025949Corn RhizosphereTVGKVWISRGAVPEVVGLWWTHAAVAILALLVVSGPTLANRIRYRVRGL
Ga0209863_1004881343300026281Prmafrost SoilGKVWIARGTAPYYLGLWWTHAVVIIIALAVILGPGYVNRLRYRMRGL
Ga0209218_114205423300027505Forest SoilPEAIGLWWTHVVVALIALAVILGPGAANRLRYRMRGL
Ga0209523_102405713300027548Forest SoilIPEFLGLWWTHAVVVLVALGVMVGPGLAYRVRYRIRGL
Ga0209420_115665123300027648Forest SoilWLGLWWTHVAVVLLALAVIALPRVANRLRYRVRTA
Ga0209178_143689913300027725Agricultural SoilIPAVIGLWWTHIAVALLALAVIFAPQGAQRLRYRMRRA
Ga0209693_1027323723300027855SoilVLLGRDTLPLFLGLWWTHAVVVALALLVIFGPTLANRLRYRVRGL
Ga0209465_1047993623300027874Tropical Forest SoilEVVGLWWTHVVVALLALAVIVGPGIANRVRYRMRGL
Ga0209062_113630613300027965Surface SoilPVALGLWWAHAAVILLALAVIFAPQAAQRLRYRLAGTA
Ga0311340_1100937723300029943PalsaWIARGTLPEVVGLWWTHVAVALVALAVIVGPGVANRLRYRMRGL
Ga0318516_1083866313300031543SoilWLGLWWTHVAVVLLALLVIAAPGLRNRMRYRMRGA
Ga0318534_1006471153300031544SoilNLATTGKTWIVRGTLPEAVGLWWTHAVVALLALLVILGPGLAHRLRYRMRGL
Ga0318573_1002595053300031564SoilPEAVGLWWTHVAVALLALAVIVGPRIAHRLRYRMRGL
Ga0318560_1077162223300031682SoilTWIARGTLPEAVGLWWTHMVVALLALVVIVGPRIANRLRYRMRGL
Ga0307469_1003360043300031720Hardwood Forest SoilKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLANRLRYRVRGL
Ga0318500_1049603513300031724SoilYYNLATTARTWIARGTLPEVVGLWWTHVVVALLALAVIMGPRIAHRVRYRMRGL
Ga0318501_1002041353300031736SoilTGRTWIARGTLPEAVGLWWTHVAVALLALAVIVGPRIAHRLRYRMRGL
Ga0307468_10069229713300031740Hardwood Forest SoilVIFFLYVNLISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLANRLRYRVRGL
Ga0306918_1051391623300031744SoilVRGTLPEAVGLWWTHAVVALLALLVILGPGLAHRLRYRMRGL
Ga0318502_1091031223300031747SoilLIFFIYYNLATTGRTLIARNTVPEVVGLWWTHVVVGLLALGVILGPGLIHRLRYRMRRQ
Ga0307477_1053509313300031753Hardwood Forest SoilIARGALPQALGLWWTHAAVALLALAVVLGPRLAHRLRYRMGRL
Ga0318535_1011467913300031764SoilFVYYNLATTGKTWIARGTVPEVVGLWWTHVVVALLALAVIVVPGLINRLRYRLRYGTRGV
Ga0318546_1110960923300031771SoilNLATTGKTWIVRGTLPEAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL
Ga0318547_1039210323300031781SoilQAVGLWWTHLVVALLALAVIVGPRIAHRVRYRMRGL
Ga0318568_1003062213300031819SoilTWIARGTLPEWVGLWWTHVAVTLLALAVILGPRIANRVRYRMRGL
Ga0318568_1094663423300031819SoilVPEALGLWWTHAVVALLALAFIMGPGLVTRLRYRFSRL
Ga0307478_1018934433300031823Hardwood Forest SoilYFLYQNLITVGKVWISRGTIPEVAGLWWTHAAVVLLALTVILGPTVATRVRNRVRGL
Ga0318527_1012702613300031859SoilEAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL
Ga0306925_1216685813300031890SoilRGTLPEVMGLWWTHVAVVLIALLVIFAPGLAHRLRYRMRSP
Ga0310912_1137640213300031941SoilEAVGLWWTHVAVALLALAVIVGPRIAHRLRYRMRGL
Ga0310916_1037573823300031942SoilVVGLWWTHVVVALLALAVIVVPGLINRLRYRLRYGTRGV
Ga0310910_1057173923300031946SoilIARGTLPQAVGLWWTHLVVALLALAVIVGPRIAHRVRYRMRGL
Ga0306926_1087371313300031954SoilGSLPEFVGLWWTHIAVTLLALLVIVSPRLTYRLRYRMRNP
Ga0306926_1243611713300031954SoilVVGLWWTHAVVVLLALLVILGPGVANRLRYRLRGL
Ga0310911_1028173923300032035SoilIFFIYYNLATTARTWIARGTLPEVVGLWWTHVVVALLALAVIVGPRIAHRVRYRMRGL
Ga0318558_1058390013300032044SoilYYNLATTGRTWIARGTLPEWVGLWWTHVVVTLLALAVILGPGIAHRVRYRMRGL
Ga0318570_1002489313300032054SoilATTGRTWIARGTLPEAVGLWWTHAVVALLALAVILGPGIANRLRYRMRGL
Ga0318513_1001797453300032065SoilAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL
Ga0307471_10073627413300032180Hardwood Forest SoilGTVPVALGLWWTHAAVVLLALAVIVGPGLVNRLRYRVRRL
Ga0307472_10164233313300032205Hardwood Forest SoilVLIFFLYYALASTGKTWIARGTAPEVLGLWWTHLVVGLLALAVILGPGVANRVRYRMRGL
Ga0306920_10039779513300032261SoilVVGLWWTHVVVALLALAVIMGPRIAHRVRYRMRGL
Ga0306920_10185394023300032261SoilAPPWLGLWWTHVAVVLLALLVIAAPGLRNRMRYRMRGA
Ga0335081_1025846743300032892SoilRGTVPAVLGLWWTHAAVALLALAVILGPMLANRLRYRVRRL
Ga0335073_1148684323300033134SoilGQQWIVHGEVPVAVGLWWTHAAVALLAVAVIFGPHLAQRLRYRMAAR
Ga0310914_1028134933300033289SoilAVGLWWTHAVVALLALAVILGPGIANRLRYRMRGL
Ga0314866_003593_1619_17293300033807PeatlandVVLGLWWTHAVVVLLALAVIVGPGLMNRLRYRVRRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.