Basic Information | |
---|---|
Family ID | F101375 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 42 residues |
Representative Sequence | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 19.61 % |
% of genes near scaffold ends (potentially truncated) | 20.59 % |
% of genes from short scaffolds (< 2000 bps) | 86.27 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.569 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.314 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF01694 | Rhomboid | 1.96 |
PF00118 | Cpn60_TCP1 | 0.98 |
PF00881 | Nitroreductase | 0.98 |
PF07998 | Peptidase_M54 | 0.98 |
PF00582 | Usp | 0.98 |
PF00149 | Metallophos | 0.98 |
PF04930 | FUN14 | 0.98 |
PF14417 | MEDS | 0.98 |
PF00578 | AhpC-TSA | 0.98 |
PF02230 | Abhydrolase_2 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG1913 | Predicted Zn-dependent protease | General function prediction only [R] | 0.98 |
COG2383 | Uncharacterized membrane protein, Fun14 family | Function unknown [S] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.00 % |
Unclassified | root | N/A | 50.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918013|NODE_528029_length_1044_cov_7.358238 | Not Available | 1076 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0652187 | All Organisms → cellular organisms → Archaea | 1357 | Open in IMG/M |
3300000041|ARcpr5oldR_c010952 | Not Available | 774 | Open in IMG/M |
3300000787|JGI11643J11755_11524722 | All Organisms → cellular organisms → Archaea | 1393 | Open in IMG/M |
3300000787|JGI11643J11755_11753395 | All Organisms → Viruses → Predicted Viral | 2288 | Open in IMG/M |
3300003990|Ga0055455_10284086 | Not Available | 528 | Open in IMG/M |
3300004006|Ga0055453_10062397 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
3300004114|Ga0062593_102172921 | Not Available | 621 | Open in IMG/M |
3300004114|Ga0062593_102569234 | All Organisms → cellular organisms → Archaea | 578 | Open in IMG/M |
3300004479|Ga0062595_100100400 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 1536 | Open in IMG/M |
3300005045|Ga0071328_149474 | All Organisms → cellular organisms → Archaea | 2869 | Open in IMG/M |
3300005045|Ga0071328_163328 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2466 | Open in IMG/M |
3300005045|Ga0071328_176462 | All Organisms → cellular organisms → Archaea | 4701 | Open in IMG/M |
3300005093|Ga0062594_100558230 | All Organisms → cellular organisms → Archaea | 989 | Open in IMG/M |
3300005093|Ga0062594_100798580 | All Organisms → cellular organisms → Archaea | 872 | Open in IMG/M |
3300005093|Ga0062594_101486104 | Not Available | 694 | Open in IMG/M |
3300005093|Ga0062594_101786716 | Not Available | 647 | Open in IMG/M |
3300005289|Ga0065704_10265420 | Not Available | 955 | Open in IMG/M |
3300005293|Ga0065715_10022016 | All Organisms → cellular organisms → Archaea | 2289 | Open in IMG/M |
3300005441|Ga0070700_101157273 | All Organisms → cellular organisms → Archaea | 644 | Open in IMG/M |
3300005467|Ga0070706_101518870 | Not Available | 612 | Open in IMG/M |
3300005535|Ga0070684_100593873 | All Organisms → cellular organisms → Archaea | 1029 | Open in IMG/M |
3300005578|Ga0068854_101852596 | Not Available | 554 | Open in IMG/M |
3300005884|Ga0075291_1059070 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 526 | Open in IMG/M |
3300005887|Ga0075292_1074263 | Not Available | 515 | Open in IMG/M |
3300005889|Ga0075290_1066323 | All Organisms → cellular organisms → Archaea | 515 | Open in IMG/M |
3300006237|Ga0097621_101638951 | Not Available | 612 | Open in IMG/M |
3300006845|Ga0075421_100877417 | Not Available | 1026 | Open in IMG/M |
3300006847|Ga0075431_100668641 | Not Available | 1018 | Open in IMG/M |
3300006853|Ga0075420_101052144 | Not Available | 700 | Open in IMG/M |
3300006854|Ga0075425_100009162 | All Organisms → cellular organisms → Archaea | 10525 | Open in IMG/M |
3300006903|Ga0075426_10101227 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 2068 | Open in IMG/M |
3300006969|Ga0075419_10741477 | Not Available | 699 | Open in IMG/M |
3300009012|Ga0066710_101672418 | All Organisms → cellular organisms → Archaea | 970 | Open in IMG/M |
3300009012|Ga0066710_104276700 | Not Available | 534 | Open in IMG/M |
3300009146|Ga0105091_10033272 | Not Available | 2253 | Open in IMG/M |
3300009176|Ga0105242_11295773 | Not Available | 752 | Open in IMG/M |
3300009176|Ga0105242_12720012 | Not Available | 545 | Open in IMG/M |
3300009819|Ga0105087_1088836 | All Organisms → cellular organisms → Archaea | 562 | Open in IMG/M |
3300010047|Ga0126382_10655505 | Not Available | 873 | Open in IMG/M |
3300010371|Ga0134125_10066585 | All Organisms → cellular organisms → Archaea | 4010 | Open in IMG/M |
3300010371|Ga0134125_11513859 | Not Available | 731 | Open in IMG/M |
3300010371|Ga0134125_12959325 | Not Available | 515 | Open in IMG/M |
3300010373|Ga0134128_10634796 | All Organisms → cellular organisms → Archaea | 1188 | Open in IMG/M |
3300010375|Ga0105239_12100080 | All Organisms → cellular organisms → Archaea | 656 | Open in IMG/M |
3300011003|Ga0138514_100004200 | All Organisms → cellular organisms → Archaea | 2051 | Open in IMG/M |
3300011003|Ga0138514_100040419 | All Organisms → cellular organisms → Archaea | 915 | Open in IMG/M |
3300011119|Ga0105246_10535953 | Not Available | 1001 | Open in IMG/M |
3300012204|Ga0137374_10051223 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4249 | Open in IMG/M |
3300012355|Ga0137369_10324428 | All Organisms → cellular organisms → Archaea | 1133 | Open in IMG/M |
3300012668|Ga0157216_10352576 | Not Available | 662 | Open in IMG/M |
3300012684|Ga0136614_10246502 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1337 | Open in IMG/M |
3300012937|Ga0162653_100011861 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1065 | Open in IMG/M |
3300012941|Ga0162652_100028230 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 827 | Open in IMG/M |
3300012951|Ga0164300_10769397 | Not Available | 593 | Open in IMG/M |
3300012951|Ga0164300_10776921 | Not Available | 591 | Open in IMG/M |
3300012955|Ga0164298_10619832 | All Organisms → cellular organisms → Archaea | 746 | Open in IMG/M |
3300012957|Ga0164303_10497331 | Not Available | 780 | Open in IMG/M |
3300012957|Ga0164303_10628140 | Not Available | 712 | Open in IMG/M |
3300012957|Ga0164303_10692034 | Not Available | 686 | Open in IMG/M |
3300012961|Ga0164302_10182163 | All Organisms → cellular organisms → Archaea | 1273 | Open in IMG/M |
3300012984|Ga0164309_11691822 | All Organisms → cellular organisms → Archaea | 542 | Open in IMG/M |
3300012984|Ga0164309_11935905 | Not Available | 505 | Open in IMG/M |
3300012985|Ga0164308_10881716 | Not Available | 787 | Open in IMG/M |
3300012989|Ga0164305_10147712 | Not Available | 1590 | Open in IMG/M |
3300012989|Ga0164305_10610328 | All Organisms → cellular organisms → Archaea | 878 | Open in IMG/M |
3300013297|Ga0157378_13213924 | All Organisms → cellular organisms → Archaea | 508 | Open in IMG/M |
3300015371|Ga0132258_13501319 | All Organisms → cellular organisms → Archaea | 1075 | Open in IMG/M |
3300015372|Ga0132256_100161533 | All Organisms → cellular organisms → Archaea | 2259 | Open in IMG/M |
3300015373|Ga0132257_100101306 | All Organisms → cellular organisms → Archaea | 3315 | Open in IMG/M |
3300015373|Ga0132257_103828886 | Not Available | 547 | Open in IMG/M |
3300017997|Ga0184610_1120397 | Not Available | 845 | Open in IMG/M |
3300018027|Ga0184605_10371653 | Not Available | 644 | Open in IMG/M |
3300018028|Ga0184608_10338931 | Not Available | 660 | Open in IMG/M |
3300018056|Ga0184623_10521293 | Not Available | 505 | Open in IMG/M |
3300018061|Ga0184619_10146016 | All Organisms → cellular organisms → Archaea | 1078 | Open in IMG/M |
3300018071|Ga0184618_10480215 | Not Available | 522 | Open in IMG/M |
3300019868|Ga0193720_1028398 | Not Available | 797 | Open in IMG/M |
3300019876|Ga0193703_1047580 | Not Available | 659 | Open in IMG/M |
3300019879|Ga0193723_1021415 | All Organisms → cellular organisms → Archaea | 1980 | Open in IMG/M |
3300019881|Ga0193707_1022253 | All Organisms → cellular organisms → Archaea | 2096 | Open in IMG/M |
3300021078|Ga0210381_10043698 | All Organisms → cellular organisms → Archaea | 1317 | Open in IMG/M |
3300021078|Ga0210381_10063181 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1139 | Open in IMG/M |
3300021344|Ga0193719_10415217 | All Organisms → cellular organisms → Archaea | 552 | Open in IMG/M |
3300022756|Ga0222622_10384465 | All Organisms → cellular organisms → Archaea | 985 | Open in IMG/M |
3300025910|Ga0207684_11254827 | Not Available | 612 | Open in IMG/M |
3300026121|Ga0207683_10219737 | Not Available | 1731 | Open in IMG/M |
3300027577|Ga0209874_1153624 | All Organisms → cellular organisms → Archaea | 517 | Open in IMG/M |
3300027787|Ga0209074_10454543 | Not Available | 548 | Open in IMG/M |
3300027907|Ga0207428_10926926 | Not Available | 614 | Open in IMG/M |
3300030829|Ga0308203_1022707 | All Organisms → cellular organisms → Archaea | 827 | Open in IMG/M |
3300030829|Ga0308203_1070528 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 561 | Open in IMG/M |
3300031091|Ga0308201_10064778 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 962 | Open in IMG/M |
3300031092|Ga0308204_10101175 | All Organisms → cellular organisms → Archaea | 795 | Open in IMG/M |
3300031226|Ga0307497_10475334 | Not Available | 612 | Open in IMG/M |
3300031547|Ga0310887_10478815 | Not Available | 746 | Open in IMG/M |
3300031562|Ga0310886_10542743 | Not Available | 707 | Open in IMG/M |
3300031847|Ga0310907_10741166 | Not Available | 546 | Open in IMG/M |
3300032075|Ga0310890_10634004 | Not Available | 831 | Open in IMG/M |
3300032122|Ga0310895_10573249 | Not Available | 576 | Open in IMG/M |
3300032179|Ga0310889_10076417 | Not Available | 1375 | Open in IMG/M |
3300032211|Ga0310896_10233857 | All Organisms → cellular organisms → Archaea | 922 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.86% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.86% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 3.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.92% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.94% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.96% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.98% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Iowa-Corn-GraphCirc_00103580 | 2140918013 | Soil | MCFEFEIPIKRKTKNPNMIDEEFEVEPELEKVQEPVTVSAK |
ICChiseqgaiiDRAFT_06521872 | 3300000033 | Soil | MCFEFEIPNKAKYKNXNXIVEDREIEPELEKVEEPVTVSAR* |
ARcpr5oldR_0109521 | 3300000041 | Arabidopsis Rhizosphere | MCFEFEIPNKKKDKNLNMIDEEFEVEPELEKVQEPVTVSVK* |
JGI11643J11755_115247221 | 3300000787 | Soil | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN* |
JGI11643J11755_117533953 | 3300000787 | Soil | MCFEFEIPIKRKTKNPNMIDEEFEVEPELEKVQEPVTVSAK* |
Ga0055455_102840861 | 3300003990 | Natural And Restored Wetlands | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS* |
Ga0055453_100623971 | 3300004006 | Natural And Restored Wetlands | MCFEFEIPNKKKDKNLNTIDEELEVEPELKKVQEPITVSIN* |
Ga0062593_1021729212 | 3300004114 | Soil | MCFEFEIPNKKKDKNLHTIDEELEVEPELGKAQEPVTVSAK* |
Ga0062593_1025692342 | 3300004114 | Soil | YYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS* |
Ga0062595_1001004002 | 3300004479 | Soil | MCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEEPITITAN* |
Ga0071328_1494743 | 3300005045 | Permafrost | MQYYTMCFEFEIPNKKKDKKINTIDEELEVEPELEKVEEPVKVSVN* |
Ga0071328_1633282 | 3300005045 | Permafrost | MCFEFEIPSKKKYKNLNMIDEELEFEPELEKVQEPVTGSVN* |
Ga0071328_1764623 | 3300005045 | Permafrost | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVVEPVTVSAS* |
Ga0062594_1005582302 | 3300005093 | Soil | MCFELEIPNKKKDKNGNMIDEEFEVEPELGKVQEPVTVPAN* |
Ga0062594_1007985801 | 3300005093 | Soil | MCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSTS* |
Ga0062594_1014861041 | 3300005093 | Soil | MCFEFEIPNKKKDKNVNMIDEEFEVEPELEKVQEPVTVSAN* |
Ga0062594_1017867162 | 3300005093 | Soil | MCFEFEIPIRKKDKNLNMIDEEFEVEPELEKVQEPVTVSAK* |
Ga0065704_102654201 | 3300005289 | Switchgrass Rhizosphere | LYFECTKDIMCFEFEIPSRIKSKNVNVINEEDVEIEPELEKVEEPVTVSVN* |
Ga0065715_100220162 | 3300005293 | Miscanthus Rhizosphere | MCFEFEIPNKAKYKNKNEIEDREIEPELEKVEEPVTVSAS* |
Ga0070700_1011572733 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MCFEFEIPNKKKDKNLNMIDEEFEVEPELEKVQEPVTVSAK* |
Ga0070706_1015188702 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MCFEFEIPYKMRYKNKIRVNEEDLENDPELEKVEEPITITAN* |
Ga0070684_1005938731 | 3300005535 | Corn Rhizosphere | MSFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAS* |
Ga0068854_1018525962 | 3300005578 | Corn Rhizosphere | MCFEFEIPNKAKYKNKNEIVEDMEIEPEPEKVEESVIVSAS* |
Ga0075291_10590701 | 3300005884 | Rice Paddy Soil | IMCFELEIPNKKKDKNLNTIDEELEVEPELEKVQEPVTVLVK* |
Ga0075292_10742631 | 3300005887 | Rice Paddy Soil | MCFEFEIPNKKKDKSLNTIDEELEVEPELEKVEEPVTVSVN* |
Ga0075290_10663232 | 3300005889 | Rice Paddy Soil | MVRKISDYIMCFELEIPNKKKDKNLNTIDEELEVEPELEKVQEPVTVLVK* |
Ga0097621_1016389511 | 3300006237 | Miscanthus Rhizosphere | MCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAS* |
Ga0075421_1008774171 | 3300006845 | Populus Rhizosphere | MKTQYYTMCFEFEIPSKIRYKNKNEISEDLEIEPELEKTEEPVIVSAN* |
Ga0075431_1006686412 | 3300006847 | Populus Rhizosphere | MKTQYYIMCFEFEIPSKIRYKNKNEISEDLEIEPELEKTEEPVIVSAN* |
Ga0075420_1010521441 | 3300006853 | Populus Rhizosphere | MKTQYYIMCFEFEIPSKIRYKNKNEISEDLETEPELEKTEEPVIVSAN* |
Ga0075425_10000916213 | 3300006854 | Populus Rhizosphere | MCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEE |
Ga0075426_101012271 | 3300006903 | Populus Rhizosphere | MCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEEPITIT |
Ga0075419_107414771 | 3300006969 | Populus Rhizosphere | MKTQYYIMCFEFEIPSKIRYKNKNEISEDLEIEPELEKTEEPIIVSAN* |
Ga0066710_1016724181 | 3300009012 | Grasslands Soil | MCFEFEIPYKMKYKNKTRIDEEDLENEPELEKVEEPITISAN |
Ga0066710_1042767001 | 3300009012 | Grasslands Soil | MCFEFEIPNKVKYKGKKEINEDVVSEPELEKVEEPVTISAK |
Ga0105091_100332723 | 3300009146 | Freshwater Sediment | MCFEFEIPSKIRYKNKNEISEDLEIEPELEKAEEPVIVSAN* |
Ga0105242_112957731 | 3300009176 | Miscanthus Rhizosphere | MCFEFEIPIRKKDKNHNMIDEEFEVEPELEKVQEPVTVSAK* |
Ga0105242_127200121 | 3300009176 | Miscanthus Rhizosphere | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVAAS* |
Ga0105087_10888362 | 3300009819 | Groundwater Sand | MCFEFEIPSKIKNKNKNEVSDDVEIEPELEKVEEPVIVSAN* |
Ga0126382_106555051 | 3300010047 | Tropical Forest Soil | MCFDFEITSKIRYKNKNEISEELEIEPELEKSERPEPVIVSAN* |
Ga0134125_100665854 | 3300010371 | Terrestrial Soil | MCFEFEIPNKAKYKNKNEIVEDREIETELEKVEEPVTVSAS* |
Ga0134125_115138591 | 3300010371 | Terrestrial Soil | MCIEFEILNKKKVKNLNNTIDEELEVGPELEKVQEPVTVSVN* |
Ga0134125_129593252 | 3300010371 | Terrestrial Soil | MCFEFEIPNKKKDKNLNIIDEDNTEIEPELEKIQEPVTVSVT* |
Ga0134128_106347962 | 3300010373 | Terrestrial Soil | MSFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSTS* |
Ga0105239_121000801 | 3300010375 | Corn Rhizosphere | FEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSAK* |
Ga0138514_1000042002 | 3300011003 | Soil | MCFEFEIPNKAKYKNKNEIVEDGEIEPELEKVEEPVTVSAS* |
Ga0138514_1000404192 | 3300011003 | Soil | MCFEFEIPNKKKDKNLNTIDEEFEVEPELEKVQEQVTVLAN* |
Ga0105246_105359531 | 3300011119 | Miscanthus Rhizosphere | MCFEFEIPNKAKYKNKNEIVEDREFEPELEKVEEPVTVSAS* |
Ga0137374_100512234 | 3300012204 | Vadose Zone Soil | MKHNYQIMCFEYEIPNKMQYKSKNEINEDEDIEPELEKVEETVTISSK* |
Ga0137369_103244282 | 3300012355 | Vadose Zone Soil | MCFEYEIPNKMQYKSKNEINEDEDIEPELEKVEETVTISSK* |
Ga0157216_103525762 | 3300012668 | Glacier Forefield Soil | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSVS* |
Ga0136614_102465022 | 3300012684 | Polar Desert Sand | MKCFEFEIPNKKKDKNLNMNDEELEVEPELEKVQEPVTVSVN* |
Ga0162653_1000118613 | 3300012937 | Soil | YYTMCIEFEILNKKKDKNLNNTIDEELEVGPEFEKVQEPVTVSVN* |
Ga0162652_1000282302 | 3300012941 | Soil | NKKKDKNLNNTIDEELEVGPEFEKVQEPVTVSVN* |
Ga0164300_107693972 | 3300012951 | Soil | MCLEFEIPNKAKYKNKNEIVEDIEIEPELEKVEEPVTVSAS* |
Ga0164300_107769211 | 3300012951 | Soil | MCFEFEIPIKKKDKNLHTIDEELEVEPELEKVQEPVTVSIK* |
Ga0164298_106198322 | 3300012955 | Soil | MAIYYLMCFEFEIPITKKDKNLNIIDEELEVEPELEKVQEPVTVSAK* |
Ga0164303_104973312 | 3300012957 | Soil | MCLEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN* |
Ga0164303_106281402 | 3300012957 | Soil | MCFAFEIPTKRKTKDPNMIDEEFEVEPELEKVQEPVTVSAK* |
Ga0164303_106920342 | 3300012957 | Soil | MCFEFEIPNKAKYKNKNEIVEDREIEPELERVEEPVTVSAR* |
Ga0164302_101821632 | 3300012961 | Soil | MCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHV |
Ga0164309_116918222 | 3300012984 | Soil | IYYLMCFEFEIPITKKDKNLNIIDEELEVEPELEKVQEPVTV* |
Ga0164309_119359051 | 3300012984 | Soil | MCLEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS* |
Ga0164308_108817161 | 3300012985 | Soil | MCFEFEIPNKTKYKNKNEIVEDREIEPELEKVEEPVTVSAN* |
Ga0164305_101477121 | 3300012989 | Soil | MCFEFEIPNKAKYKNKNEIEDREIEPELEKVEEPVTVSAN* |
Ga0164305_106103282 | 3300012989 | Soil | MCFEFEIPNKKKDKNLHTIDEELEVEPELEKVQEPVTVSI |
Ga0157378_132139242 | 3300013297 | Miscanthus Rhizosphere | MCFEFEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSAK* |
Ga0132258_135013191 | 3300015371 | Arabidopsis Rhizosphere | YLMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAN* |
Ga0132256_1001615332 | 3300015372 | Arabidopsis Rhizosphere | MCFEFEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSSK* |
Ga0132257_1001013062 | 3300015373 | Arabidopsis Rhizosphere | MCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAN* |
Ga0132257_1038288862 | 3300015373 | Arabidopsis Rhizosphere | FEIPSKIRYKNKNEISEEFEIEPELEKAEEPEPVLVSAN* |
Ga0184610_11203972 | 3300017997 | Groundwater Sediment | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS |
Ga0184605_103716532 | 3300018027 | Groundwater Sediment | MCIEFEILNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN |
Ga0184608_103389311 | 3300018028 | Groundwater Sediment | MCFEFEIPNKKKDKNLDMIDEDNTEIEPEPERVQEPVTVSVK |
Ga0184623_105212931 | 3300018056 | Groundwater Sediment | MCFEFEIPNKAKYKNKNEIVEDMEIEPELEKVEESVTVSAS |
Ga0184619_101460162 | 3300018061 | Groundwater Sediment | MCFEFEIPNKKKDKNLNTIEEDLDVEPELEKVQEPVTVSVK |
Ga0184618_104802152 | 3300018071 | Groundwater Sediment | MCFEFEIPNKKKDKNLNTIDEEFEVEPELEKVQEPVTVSAN |
Ga0193720_10283982 | 3300019868 | Soil | MCFEFEIPNKKKDKNVNMIDEEFEVEPELEKVQEPVTVSAN |
Ga0193703_10475801 | 3300019876 | Soil | LNVYYYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS |
Ga0193723_10214151 | 3300019879 | Soil | YYYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS |
Ga0193707_10222533 | 3300019881 | Soil | MCFEFEIPNKKKGKNLNTIEEDLDIEPELEKVQEPVTVSVK |
Ga0210381_100436983 | 3300021078 | Groundwater Sediment | MCFEFEIPNKAKYKNKNEIVEDRENEPELEKVEEPVTVSAS |
Ga0210381_100631811 | 3300021078 | Groundwater Sediment | MCFEFEIPNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN |
Ga0193719_104152172 | 3300021344 | Soil | YFIMCFEFEIPNKKKGKNLNTIEEDLDIEPELEKVQEPVTVSVK |
Ga0222622_103844652 | 3300022756 | Groundwater Sediment | IPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS |
Ga0207684_112548272 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MCFEFEIPYKMRYKNKIRVNEEDLENDPELEKVEEPITITAN |
Ga0207683_102197373 | 3300026121 | Miscanthus Rhizosphere | MCFEFEIPNKKKDKNVNMIDEEFEVEPELEKVQEPVTVSAK |
Ga0209874_11536242 | 3300027577 | Groundwater Sand | MCFEFEIPSKIKNKNKNEVSDDVEIEPELEKVEEPVIVSAN |
Ga0209074_104545431 | 3300027787 | Agricultural Soil | MCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEEPITITAN |
Ga0207428_109269262 | 3300027907 | Populus Rhizosphere | MCFEFEIPNKKKDKNLNMIDEEFEVEPELEKVQEPVTVSVK |
Ga0308203_10227071 | 3300030829 | Soil | EIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS |
Ga0308203_10705282 | 3300030829 | Soil | FEILNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN |
Ga0308201_100647781 | 3300031091 | Soil | EFEILNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN |
Ga0308204_101011751 | 3300031092 | Soil | NVYYYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS |
Ga0307497_104753341 | 3300031226 | Soil | MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN |
Ga0310887_104788153 | 3300031547 | Soil | MCFEFEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSAK |
Ga0310886_105427431 | 3300031562 | Soil | MCFEFEIPNKARSKNKNEIVEDTETAPELEKLEEHVTVSAS |
Ga0310907_107411662 | 3300031847 | Soil | MCFEFEIPNKAKYKNKNEIVEDMEIEPEPEKVEESVIVSAS |
Ga0310890_106340042 | 3300032075 | Soil | MCFEFEIPIRKKDKNHNMIDEEFEVEPELEKVQEPVTVSAK |
Ga0310895_105732491 | 3300032122 | Soil | MCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAS |
Ga0310889_100764172 | 3300032179 | Soil | MCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSTS |
Ga0310896_102338572 | 3300032211 | Soil | MCFEFEIPIRKKDKNLNMIDEEFEVEPELEKVQEPVTVSAK |
⦗Top⦘ |