NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101198

Metagenome / Metatranscriptome Family F101198

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101198
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 82 residues
Representative Sequence VAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Number of Associated Samples 98
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.43 %
% of genes near scaffold ends (potentially truncated) 45.10 %
% of genes from short scaffolds (< 2000 bps) 89.22 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(28.431 % of family members)
Environment Ontology (ENVO) Unclassified
(49.020 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(36.275 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.28%    β-sheet: 11.11%    Coil/Unstructured: 71.60%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF04002RadC 37.25
PF06067DUF932 6.86
PF16793RepB_primase 1.96
PF12728HTH_17 0.98
PF00589Phage_integrase 0.98
PF00355Rieske 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2003DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motifReplication, recombination and repair [L] 37.25


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003994|Ga0055435_10272326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37502Open in IMG/M
3300004019|Ga0055439_10094480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37879Open in IMG/M
3300004479|Ga0062595_101325379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37650Open in IMG/M
3300004480|Ga0062592_100437537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371056Open in IMG/M
3300005364|Ga0070673_101323134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37677Open in IMG/M
3300005544|Ga0070686_101035887All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37675Open in IMG/M
3300005544|Ga0070686_101227119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37624Open in IMG/M
3300005833|Ga0074472_10240412All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300005836|Ga0074470_11739968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37810Open in IMG/M
3300005890|Ga0075285_1052118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37551Open in IMG/M
3300006417|Ga0069787_11660280All Organisms → cellular organisms → Bacteria → Proteobacteria1187Open in IMG/M
3300009078|Ga0105106_10980410All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300009098|Ga0105245_11227043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37798Open in IMG/M
3300009100|Ga0075418_12893470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37524Open in IMG/M
3300009147|Ga0114129_12179873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37667Open in IMG/M
3300009553|Ga0105249_13349752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37516Open in IMG/M
3300009597|Ga0105259_1007826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-372044Open in IMG/M
3300009678|Ga0105252_10078865All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371292Open in IMG/M
3300009801|Ga0105056_1041412All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37625Open in IMG/M
3300009804|Ga0105063_1010330All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300009811|Ga0105084_1052970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37721Open in IMG/M
3300009816|Ga0105076_1008802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371685Open in IMG/M
3300009873|Ga0131077_10297951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371606Open in IMG/M
3300010166|Ga0126306_10184888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371567Open in IMG/M
3300010371|Ga0134125_12137042All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37609Open in IMG/M
3300010391|Ga0136847_12239453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300011106|Ga0151489_1273663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300011405|Ga0137340_1037067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37917Open in IMG/M
3300011409|Ga0137323_1032600All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300011416|Ga0137422_1012590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371956Open in IMG/M
3300011429|Ga0137455_1029814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371506Open in IMG/M
3300011432|Ga0137428_1091540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37854Open in IMG/M
3300011437|Ga0137429_1010143All Organisms → cellular organisms → Bacteria2695Open in IMG/M
3300011438|Ga0137451_1041111All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371349Open in IMG/M
3300011439|Ga0137432_1002858All Organisms → cellular organisms → Bacteria4879Open in IMG/M
3300011440|Ga0137433_1004794All Organisms → cellular organisms → Bacteria4479Open in IMG/M
3300012021|Ga0120192_10017771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371096Open in IMG/M
3300012022|Ga0120191_10174009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37509Open in IMG/M
3300012038|Ga0137431_1007181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-373115Open in IMG/M
3300012159|Ga0137344_1058235All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37695Open in IMG/M
3300012166|Ga0137350_1023558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371150Open in IMG/M
3300012167|Ga0137319_1013489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371683Open in IMG/M
3300012174|Ga0137338_1008782All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300012175|Ga0137321_1011035All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300012179|Ga0137334_1009894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371766Open in IMG/M
3300012231|Ga0137465_1002601All Organisms → cellular organisms → Bacteria5209Open in IMG/M
3300012353|Ga0137367_10462214All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300012355|Ga0137369_10182426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371639Open in IMG/M
3300012519|Ga0157352_1027232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37735Open in IMG/M
3300012893|Ga0157284_10095306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37768Open in IMG/M
3300012909|Ga0157290_10092979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium876Open in IMG/M
3300012922|Ga0137394_10870445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37753Open in IMG/M
3300012957|Ga0164303_11170874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37560Open in IMG/M
3300012960|Ga0164301_10978521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37663Open in IMG/M
3300012987|Ga0164307_10608781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37843Open in IMG/M
3300013306|Ga0163162_12857743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37556Open in IMG/M
3300013308|Ga0157375_10488239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371396Open in IMG/M
3300014255|Ga0075320_1041338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37809Open in IMG/M
3300014270|Ga0075325_1173062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37561Open in IMG/M
3300014299|Ga0075303_1090333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37582Open in IMG/M
3300014302|Ga0075310_1039608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37899Open in IMG/M
3300014325|Ga0163163_11579212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37717Open in IMG/M
3300014865|Ga0180078_1000960All Organisms → cellular organisms → Bacteria3245Open in IMG/M
3300014866|Ga0180090_1073349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37607Open in IMG/M
3300014875|Ga0180083_1005627All Organisms → cellular organisms → Bacteria → Acidobacteria1979Open in IMG/M
3300014876|Ga0180064_1005567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-372566Open in IMG/M
3300014880|Ga0180082_1006717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-372274Open in IMG/M
3300014885|Ga0180063_1279418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37531Open in IMG/M
3300015249|Ga0180071_1008146All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300015253|Ga0180081_1046535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37735Open in IMG/M
3300015255|Ga0180077_1007004All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371783Open in IMG/M
3300015256|Ga0180073_1034215All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37996Open in IMG/M
3300015372|Ga0132256_100914555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37993Open in IMG/M
3300017966|Ga0187776_11223858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37564Open in IMG/M
3300018053|Ga0184626_10153528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37979Open in IMG/M
3300018075|Ga0184632_10417886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37561Open in IMG/M
3300018429|Ga0190272_11247936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37734Open in IMG/M
3300018469|Ga0190270_11640919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37695Open in IMG/M
3300019377|Ga0190264_10249648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371028Open in IMG/M
3300019377|Ga0190264_10637684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37770Open in IMG/M
3300020060|Ga0193717_1086571All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300025901|Ga0207688_10812840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37592Open in IMG/M
3300025908|Ga0207643_10285198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371025Open in IMG/M
3300027209|Ga0209875_1006443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371397Open in IMG/M
3300027866|Ga0209813_10346851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37587Open in IMG/M
3300028803|Ga0307281_10078166All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371084Open in IMG/M
3300030620|Ga0302046_10435028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371077Open in IMG/M
3300031184|Ga0307499_10180548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300031226|Ga0307497_10261889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
(restricted) 3300031248|Ga0255312_1054231All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37961Open in IMG/M
3300031562|Ga0310886_10350524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37858Open in IMG/M
3300031562|Ga0310886_10455201All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37764Open in IMG/M
3300031943|Ga0310885_10041151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371869Open in IMG/M
3300032074|Ga0308173_11602858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37613Open in IMG/M
3300032157|Ga0315912_10013398All Organisms → cellular organisms → Bacteria6889Open in IMG/M
3300032770|Ga0335085_10375660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371658Open in IMG/M
3300034075|Ga0373895_054046All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300034075|Ga0373895_058222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37587Open in IMG/M
3300034080|Ga0373897_029480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37991Open in IMG/M
3300034128|Ga0370490_0002079All Organisms → cellular organisms → Bacteria → Acidobacteria8334Open in IMG/M
3300034257|Ga0370495_0038970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371429Open in IMG/M
3300034420|Ga0373918_0208792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37514Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil28.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.71%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.92%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry3.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.98%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.98%
Enhanced Biological Phosphorus Removal BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300006417Combined Assembly of Gp0110018, Gp0110022, Gp0110020EngineeredOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012167Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012175Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014302Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015249Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10DEnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300034075Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.2EngineeredOpen in IMG/M
3300034080Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.1EngineeredOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034257Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17EnvironmentalOpen in IMG/M
3300034420Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.1EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0055435_1027232613300003994Natural And Restored WetlandsMPCARQVVERPAVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGGDEPTRPREIVCVLRHLLKDSEAVTLSPVSSLDALRRPGAWLWFRD
Ga0055439_1009448013300004019Natural And Restored WetlandsVAQEQGDGDQPWELAGGQTGDGADESIEFVSDVEFVEEGVDEPTRPREIACAIRHFLKDSEAVTLSPVSSLDALRRPGAWLWFRDS
Ga0062595_10132537913300004479SoilVAQEQGDGDQPWELTGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0062592_10043753713300004480SoilVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESVDEAARPPETVGTIGEFAQNVDAVVLSPVLDLDALWRPGAWL*
Ga0070673_10132313423300005364Switchgrass RhizosphereVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPREIACAIRHFLKDSEAVTLSPVSSLDALGRPGAWLWFRDS*
Ga0070686_10103588723300005544Switchgrass RhizosphereMPCARQVVERPAVAQEQCDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPREIVCVFRHLVKDSEAVTLSPVSSLDALRRPGAWL
Ga0070686_10122711913300005544Switchgrass RhizosphereVRPAVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0074472_1024041213300005833Sediment (Intertidal)LAGGHTGDGADKSIEFVSDMEFVEESGDEAARPLETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0074470_1173996823300005836Sediment (Intertidal)VAQEQGDGDQPWELAGGQTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0075285_105211823300005890Rice Paddy SoilMPCARQVVERPAVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPRKIVSALRHLLKDSEAVTLSPVSS
Ga0069787_1166028023300006417Enhanced Biological Phosphorus Removal BioreactorVTEQQRDGDQPWELAGGHTGEGADESIEFVGDVEFVEEGGDEAARPPETVGTDREFLQNVAAVVESPVLDLDALRRPGVRL*
Ga0105106_1098041023300009078Freshwater SedimentAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0105245_1122704323300009098Miscanthus RhizosphereVAQEQGDGDQPWELAGGHTRDGADESIEFVSDVEFVEESGYEAARPTETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0075418_1289347013300009100Populus RhizosphereQPWELAGGYTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0114129_1217987323300009147Populus RhizosphereARQVVERPAVAQEQCDGDQPWELAGGHMGGGADESIEFVSDVEFVEESVDEAARPPETVGTIGEFAQNVDAVVLSPVLDLDALRRPGAWL*
Ga0105249_1334975213300009553Switchgrass RhizosphereVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPREIVCVLRHLLKDSEAVTLSPVSGLDARRRPGAWLWFRDSLAGG
Ga0105259_100782623300009597SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0105252_1007886523300009678SoilVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0105056_104141223300009801Groundwater SandVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTLGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0105063_101033023300009804Groundwater SandVAAEGVEFCFQGTDPEPDALARARQVVERPAVAQEQGDGDQPWELADGHTGDGADESIEFVSDVEFVEESNDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0105084_105297013300009811Groundwater SandVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFVQNVAAVVLSPVLDLDALRRPGARL*
Ga0105076_100880223300009816Groundwater SandVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEATRPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0131077_1029795123300009873WastewaterVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0126306_1018488823300010166Serpentine SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0134125_1213704213300010371Terrestrial SoilALARARQVVERPAVAQEHSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0136847_1223945313300010391Freshwater SedimentAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0151489_127366313300011106SoilPWELAGGHTGDGADESIEFVIDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137340_103706723300011405SoilVAQEQSNGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137323_103260013300011409SoilQVVVRPAVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEEGVDEPTRPREIVSALRHLLKNGEAVTLSPVSSLDALRRPGARL*
Ga0137422_101259023300011416SoilVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137455_102981433300011429SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLD
Ga0137428_109154023300011432SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVATVVLSPVLDLDALRRPGVRL*
Ga0137429_101014353300011437SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGPIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137451_104111113300011438SoilVAQAQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137432_100285863300011439SoilEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137433_100479423300011440SoilVAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0120192_1001777123300012021TerrestrialVAQQQRDCDQPWVLADGHTSGGTEESIEFVSDVEFVEEGVDEPTRPREIVSALRHLLKDSEAVTLSPVSSLDALGRPGAWL*
Ga0120191_1017400913300012022TerrestrialVAQQQRDGDQPRELADGHAGDGTDESIEFVSDVELVEEGVDEPTRPREIVSALRHLLKDSEAVTLSPVSSPDALRGP
Ga0137431_100718133300012038SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGPIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137344_105823523300012159SoilVAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEESGDEASRPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137350_102355813300012166SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAPMVLSPVLDLDALRRPGARL
Ga0137319_101348923300012167SoilVTQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137338_100878213300012174SoilEPDALARARQVVERPAVAQEQGDGAQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137321_101103523300012175SoilPEPDALARARQVVERPAVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137334_100989423300012179SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPRETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137465_100260163300012231SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVATVVLSPVLDLDALRRPGARL*
Ga0137367_1046221423300012353Vadose Zone SoilDGHAGDGANESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPCARL*
Ga0137369_1018242623300012355Vadose Zone SoilVAQEQRDGDQPWELADGHAGDGANESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0157352_102723213300012519Unplanted SoilVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPREIVCVLRHLLKDSEAVTLSPVSSLDALRRPGA
Ga0157284_1009530613300012893SoilMPCARQVVERPAVTQQQCDGDQPWVLADGHAGDGTDESIEFVSDVEFVEEGVDEPTRPREIVCVFRHLLKDSEAVTLSPVSSLDALRRPGAWLWSRDS*
Ga0157290_1009297913300012909SoilQGDGDQPWELAGGHTGDGADESIEFVSDVKFVEESGDEAARPLEIVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0137394_1087044513300012922Vadose Zone SoilVAQEQRDGDQPWELADGHAGDGANESIEFVSDVEFVEEGSDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALGRPGARL*
Ga0164303_1117087413300012957SoilVAQEQGDGDQPWELAGGHPGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0164301_1097852113300012960SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESDDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0164307_1060878123300012987SoilVAQEQGDGDQPWELAGGHTRDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0163162_1285774313300013306Switchgrass RhizosphereVAQEQSDGDQPWELAGGYTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0157375_1048823923300013308Miscanthus RhizosphereVAQQQRDGDQPWELADGHAGGGTDESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0075320_104133823300014255Natural And Restored WetlandsVAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEEGVDEAARPPETVGPIGEFLQNVAAVGLSPGLDLDALRRPGARL*
Ga0075325_117306213300014270Natural And Restored WetlandsVAQEQGDGNQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0075303_109033313300014299Natural And Restored WetlandsVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTVGEFLQNVATVVLSPVLDLDALRRPGAWLWFRDSLA
Ga0075310_103960813300014302Natural And Restored WetlandsVAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEEGVDEPTRPREIVSALRHLLKDSEAVTLSPVSSLDALRRPGAWLWFRDSLAGGSVAH
Ga0163163_1157921223300014325Switchgrass RhizosphereVAQEQGDGDQPWVLAGGYAGDGTDESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0180078_100096043300014865SoilMAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0180090_107334913300014866SoilMAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0180083_100562713300014875SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGAR
Ga0180064_100556713300014876SoilVAQQQRDSDQPWELADGHAGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0180082_100671723300014880SoilVAQEQGDGNQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0180063_127941813300014885SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARLSCRDSSADRAVAHGRHL
Ga0180071_100814613300015249SoilRARQVVERPAVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0180081_104653513300015253SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGTIGEFVQNVAAVVLSPVLDLDALRRPGARL*
Ga0180077_100700423300015255SoilVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFQQNVAAVVLSPVLDLDALRRPGARL*
Ga0180073_103421533300015256SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVGEGIDEPTRPREIVSTFRHLLKDSEAVTLSPVSGLD
Ga0132256_10091455523300015372Arabidopsis RhizosphereVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESRDEAARPLETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL*
Ga0187776_1122385813300017966Tropical PeatlandMPCARQVVERPAVAQQQCESDQPWELADGHAGDGTYESIEFVSDVEFVEEGVDEPTRPQEIVCALRHLLKNSEAVTLSPVSSLDA
Ga0184626_1015352823300018053Groundwater SedimentVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGGFQKNVAAVVLSPVLDLDALRRPGARL
Ga0184632_1041788613300018075Groundwater SedimentVRPAVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLS
Ga0190272_1124793613300018429SoilVRPAVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0190270_1164091913300018469SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0190264_1024964823300019377SoilVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPREIVSALRHLLKDSEAVTLSPVS
Ga0190264_1063768413300019377SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPHETVGTIGEFLQNVAAVVLSPVL
Ga0193717_108657123300020060SoilGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0207688_1081284013300025901Corn, Switchgrass And Miscanthus RhizosphereVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESDDEAARPPETVGTIGEFLQNAAAVVLSPVLDPN
Ga0207643_1028519823300025908Miscanthus RhizosphereVAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEEGVDEPTRPREIVSALRHLLKDSEAVTLSPVSSLDALRRPGAWLWFRDSLAG
Ga0209875_100644333300027209Groundwater SandVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDL
Ga0209813_1034685113300027866Populus EndosphereVTKHQREGDQPWELAGGYTRERADESIEFVSDVEFVEEGVDEPTRPREIACAIRHFLKDSEAVTLSPVSSLDALGRPGAWLWFRDS
Ga0307281_1007816623300028803SoilVAQEQGDGDQPWELAGGHTGEGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0302046_1043502813300030620SoilVAQEQSDGYQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0307499_1018054813300031184SoilQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0307497_1026188923300031226SoilDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
(restricted) Ga0255312_105423113300031248Sandy SoilVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0310886_1035052413300031562SoilMPCARQVVKRPAVAQQQRDSDQPWELADGHAGDGADESIEFVSHVEFVEEGVDEPTRPREIVSALRHLLKNGEAVTLSPVSSLDALRRPGAWLW
Ga0310886_1045520123300031562SoilMPCARQVVERPAVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPREIACAIRHFLKDSEAVTLSPVSSLDALRRPGAWLWFRD
Ga0310885_1004115113300031943SoilMPCARQVVKRPAVAQQQRDSDQPWELADGHAGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0308173_1160285813300032074SoilVTQDHRERDQPWELAGGHTGERADESIEFVSDVELVEEGGDEPTRPLQTVSAVRDFLQNVVAVVLSEVLRLDAIARPGAWLKLRDSSVRGSVAHGRHL
Ga0315912_1001339813300032157SoilVAQEQSDGDQPWELAGGHTGDGADESIEFVSDVEFVKESGDEAARPPETVGTIGEFLKNVAAVVLSPVLDLNALRRPGAR
Ga0335085_1037566043300032770SoilVAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEEGVDEPTRPREIVCVFRHLVKDSEAVTLSPVSSLDALRRPGAWLWFRDSLAGG
Ga0373895_054046_1_2013300034075Sediment SlurryGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0373895_058222_3_2813300034075Sediment SlurryVAQQQRDGDQPWVLADGHAGDRTDESIEFVSDVEFVEEGVDEPTRPREIVCVLRHLLKDSEAVTLSPVSSLDALGRPGAWLWFRDSLAGGSVA
Ga0373897_029480_614_8593300034080Sediment SlurryVAQQQRDGDQPWELADGHAGDGTDESIEFVSDVEFVEEGVDEAARPPETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0370490_0002079_2378_26233300034128Untreated Peat SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGPIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0370495_0038970_119_3643300034257Untreated Peat SoilVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPLETVGTIGEFLQNVAAVVLSPVLDLDALRRPGARL
Ga0373918_0208792_53_2983300034420Sediment SlurryVAQEQGDGDQPWELAGGHTGDGADESIEFVSDVEFVEESGDEAARPPETVGTIGEFLKNVAAVVLSPVLDLDALRRPGARL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.