NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101116

Metagenome / Metatranscriptome Family F101116

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101116
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 102 residues
Representative Sequence MERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Number of Associated Samples 86
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.47 %
% of genes near scaffold ends (potentially truncated) 32.35 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.078 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(39.216 % of family members)
Environment Ontology (ENVO) Unclassified
(39.216 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.216 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.12%    β-sheet: 24.04%    Coil/Unstructured: 53.85%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF05345He_PIG 4.90
PF10011DUF2254 3.92
PF13193AMP-binding_C 2.94
PF13191AAA_16 1.96
PF15594Imm50 1.96
PF00069Pkinase 1.96
PF13683rve_3 0.98
PF01887SAM_HAT_N 0.98
PF13424TPR_12 0.98
PF00282Pyridoxal_deC 0.98
PF00089Trypsin 0.98
PF07676PD40 0.98
PF13428TPR_14 0.98
PF01814Hemerythrin 0.98
PF01594AI-2E_transport 0.98
PF05193Peptidase_M16_C 0.98
PF00027cNMP_binding 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.84
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.98
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.98
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.08 %
UnclassifiedrootN/A3.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101259513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium803Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101613525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1135Open in IMG/M
3300000956|JGI10216J12902_100203588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1447Open in IMG/M
3300000956|JGI10216J12902_102466531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300000956|JGI10216J12902_106850035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1006Open in IMG/M
3300000956|JGI10216J12902_113242567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium995Open in IMG/M
3300000956|JGI10216J12902_117589244All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300004114|Ga0062593_100012579All Organisms → cellular organisms → Bacteria4060Open in IMG/M
3300004114|Ga0062593_100323892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1329Open in IMG/M
3300004479|Ga0062595_102160058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300004480|Ga0062592_100005596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4457Open in IMG/M
3300005104|Ga0066818_1003905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium932Open in IMG/M
3300005148|Ga0066819_1015339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300005329|Ga0070683_100238134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1731Open in IMG/M
3300005332|Ga0066388_102602853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium921Open in IMG/M
3300005338|Ga0068868_101180374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300005341|Ga0070691_10371728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300005406|Ga0070703_10413662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300005544|Ga0070686_101807853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300005564|Ga0070664_100426187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1216Open in IMG/M
3300005614|Ga0068856_101808763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300005615|Ga0070702_101704379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300005764|Ga0066903_100776802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1708Open in IMG/M
3300006049|Ga0075417_10552419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300006058|Ga0075432_10041064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1615Open in IMG/M
3300006573|Ga0074055_11676340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300006575|Ga0074053_11571072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300006576|Ga0074047_11836603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300006579|Ga0074054_11932057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300006581|Ga0074048_12694000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium860Open in IMG/M
3300006847|Ga0075431_100063843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3801Open in IMG/M
3300006881|Ga0068865_100396899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1129Open in IMG/M
3300007076|Ga0075435_100086864All Organisms → cellular organisms → Bacteria2576Open in IMG/M
3300009177|Ga0105248_11438447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300010046|Ga0126384_10078152All Organisms → cellular organisms → Bacteria2374Open in IMG/M
3300011000|Ga0138513_100054712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300011003|Ga0138514_100076916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300012937|Ga0162653_100061575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300012939|Ga0162650_100037693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium761Open in IMG/M
3300013308|Ga0157375_11400216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium824Open in IMG/M
3300014325|Ga0163163_11071839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium869Open in IMG/M
3300015371|Ga0132258_13614025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1057Open in IMG/M
3300015373|Ga0132257_100029548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5917Open in IMG/M
3300018027|Ga0184605_10051267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1756Open in IMG/M
3300018028|Ga0184608_10234831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300018054|Ga0184621_10004909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3644Open in IMG/M
3300018054|Ga0184621_10021576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1987Open in IMG/M
3300018061|Ga0184619_10272158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300018061|Ga0184619_10377885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300018067|Ga0184611_1255846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300018072|Ga0184635_10397492Not Available522Open in IMG/M
3300018074|Ga0184640_10291458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300018076|Ga0184609_10359708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300019873|Ga0193700_1067435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300019875|Ga0193701_1004232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2680Open in IMG/M
3300019875|Ga0193701_1011911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1732Open in IMG/M
3300019883|Ga0193725_1089174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300019885|Ga0193747_1002659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4496Open in IMG/M
3300019886|Ga0193727_1006147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4836Open in IMG/M
3300020001|Ga0193731_1079759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300020002|Ga0193730_1078580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium934Open in IMG/M
3300020005|Ga0193697_1122712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300020012|Ga0193732_1068697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300021073|Ga0210378_10072428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1351Open in IMG/M
3300021080|Ga0210382_10568577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300022694|Ga0222623_10211769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium751Open in IMG/M
3300025934|Ga0207686_10268599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1254Open in IMG/M
3300025944|Ga0207661_10530555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1077Open in IMG/M
3300026078|Ga0207702_10683028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1011Open in IMG/M
3300026121|Ga0207683_10777355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium889Open in IMG/M
3300027874|Ga0209465_10434771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300027909|Ga0209382_10165948All Organisms → cellular organisms → Bacteria2550Open in IMG/M
3300028713|Ga0307303_10106935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300028714|Ga0307309_10027709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1142Open in IMG/M
3300028716|Ga0307311_10059770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1023Open in IMG/M
3300028717|Ga0307298_10024862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1571Open in IMG/M
3300028720|Ga0307317_10152072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300028768|Ga0307280_10034188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1533Open in IMG/M
3300028768|Ga0307280_10310926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300028784|Ga0307282_10030234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2337Open in IMG/M
3300028784|Ga0307282_10148620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1108Open in IMG/M
3300028803|Ga0307281_10107344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300028807|Ga0307305_10024873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2714Open in IMG/M
3300028807|Ga0307305_10182760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium966Open in IMG/M
3300028828|Ga0307312_10396866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium905Open in IMG/M
3300028875|Ga0307289_10001485All Organisms → cellular organisms → Bacteria9886Open in IMG/M
3300028878|Ga0307278_10004867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6457Open in IMG/M
3300028878|Ga0307278_10036416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2242Open in IMG/M
3300028881|Ga0307277_10080489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1363Open in IMG/M
3300028885|Ga0307304_10074897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1307Open in IMG/M
3300030902|Ga0308202_1049827Not Available766Open in IMG/M
3300030903|Ga0308206_1146264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300030990|Ga0308178_1167893Not Available515Open in IMG/M
3300031091|Ga0308201_10299221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300031093|Ga0308197_10287561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300031170|Ga0307498_10002557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2909Open in IMG/M
3300031170|Ga0307498_10135698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium800Open in IMG/M
3300031170|Ga0307498_10149835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300031170|Ga0307498_10419011Not Available530Open in IMG/M
3300031226|Ga0307497_10319753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300031421|Ga0308194_10241287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300031716|Ga0310813_10617356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium961Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil39.22%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.92%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005104Soil and rhizosphere microbial communities from Laval, Canada - mgHACEnvironmentalOpen in IMG/M
3300005148Soil and rhizosphere microbial communities from Laval, Canada - mgLMAEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10125951323300000364SoilGVERYVVTTRVKPGAAPAAEELLLEGPPFDPGEAGLSAHEAYLTDDRIYLVFEGEAAQAKALALAKQHIAEVSRWEVLLWELPSTVEDVPATARCLYRWP*
INPhiseqgaiiFebDRAFT_10161352523300000364SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
JGI10216J12902_10020358823300000956SoilVERYVVTTRLKPGAAPAAEDLLQEGPPFDPGGAGLSAHEAYLTDDRIYLVFEGEAAHTKALALAKQHIVEVSRWQELVWELPSMVEDVPATARCLYRWP*
JGI10216J12902_10246653113300000956SoilRTVDRYVITTRLRPGAASAAEELLSAGPPFDPGDAGLSAHSAYLGDDRVYLVFEGESARTKALELARQHVADVSRWENLVWELPSIVEDVPATARCVYTWQLRR*
JGI10216J12902_10685003523300000956SoilQDGQMERYVVTTRLKPGAAPAAEELLLAGPPFDPAGAGLSAHAAYLGGDRVFLVFEGDAAHAKALALAKQYVVEVSRWEDLVWELPAVVDDVPADARCVYRWPALARSSLE*
JGI10216J12902_11324256713300000956SoilMERYVVTTRLKPGAAPAAKELLLAGPPFDPGEAGLSAHAAYLSADRVFLVFEGDAAHAKALALAKQYIVEVERWQDLVWELPAVIDDVPADARCLYRWP
JGI10216J12902_11758924413300000956SoilMERYVVTTRLKPGATRAAEELLSQGPPFDPAEAGLSAHAAYLTDERVYLVFEGEAAHAKALDLAKRHVADVSQWQELVWELPAVVADVPPGVRCLYRWPES
Ga0062593_10001257923300004114SoilVERYIVTTRIKPGSAPAVEELLSAGPPFDPGDACLSAHSAYLSDDRVFLVFEGEAARAKALDLARQHMGDVSRWEELVWELPAVVEEVPATARCVYGWQAPR*
Ga0062593_10032389223300004114SoilMERYVVTTRLKPGGAAAAKELLLAGPPFDPGEAGLSAHAAYLSADRVFLVFEGDAAQAKALALAKQYIVEVERWQDLVWELPAVIHDVPADARCLYRWPAEQVRTQP*
Ga0062595_10216005813300004479SoilVTTRVKPGAAPAAEELLLEGPPFDPGEAGLSAHEAYLTDDRIYLVFEGEAAEAKALALAKQHIAEVSRWEVLLWELPSTVEDVPATARCLYRWP*
Ga0062592_10000559653300004480SoilVERYVVTTRIKPGSAPAVEELLSAGPPFDPGDACLSAHSAYLSDDRVFLVFEGEAARAKALDLARQYMGDVSRWEELVWELPAVVEEVPATARCVYGWQAPR*
Ga0066818_100390523300005104SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHMIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0066819_101533923300005148SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0070683_10023813433300005329Corn RhizosphereMERYVVTTRLKPGAAPAAEELLLAGPPFDPAGAGLSAHAAYLGGDRVFLVFEGDAAHAKALALAKQYVVEVSRWEDLVWELPAVVDDVPADARCVYRWPALARSRLE*
Ga0066388_10260285313300005332Tropical Forest SoilMERYVVTTRLKPGAAHAAEELLSQGPPFDPAEAGLSAHAAYLTDDRVFLMFEGEAAHATALSLAKQHVIEVSQWQELVWELPSVVGDVPPDARCLYRWPEPPLSVTP*
Ga0068868_10118037413300005338Miscanthus RhizosphereMERYVVATRLKPGAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHLIEVSRWQDIVWELPSVIADVPADARCLYRW
Ga0070691_1037172813300005341Corn, Switchgrass And Miscanthus RhizosphereMERYVVATRLKPRAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEGEAAHATALRLAKEHVIEVSRWQDIVWELPSAIGDVPTDARCLYRWPPSSESPT*
Ga0070703_1041366213300005406Corn, Switchgrass And Miscanthus RhizosphereANLAGGAMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPPSSESPT*
Ga0070686_10180785323300005544Switchgrass RhizosphereRLKPGAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHLIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRG*
Ga0070664_10042618733300005564Corn RhizosphereTRLKPGAAPAAEELLLAGPPFDPAGAGLSAHAAYLGGDRVFLVFEGDAAHAKALALAKQYVVEVSRWEDLVWELPAVVDDVPADARCVYRWPALARSRLE*
Ga0068856_10180876313300005614Corn RhizosphereMERYVVTTRLKPGAAPAAEELLLAGPPFDPAGAGLSAHAAYLGGDNVFLVFEGDAAHAKALALAKQYVVEVSRWEDLVWELPAVVDDVPADARCVYRWPALARSRLE*
Ga0070702_10170437913300005615Corn, Switchgrass And Miscanthus RhizosphereMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLLFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWQVDRG*
Ga0066903_10077680223300005764Tropical Forest SoilLERYVVTTRLKPGAAPAAEELLLAGPPFDPGEAGLSAHAAYLGDDRVFLVFEGDAAHTKAIALAKQYVLEVRRWEELVWELPAVIDEVPAEARCLYRWPV*
Ga0075417_1055241923300006049Populus RhizosphereVERYVVTTRIKPGSAPAVEELLSAGPPFDPGDAGLSAHSAYLSDDRVFLVFEGEAARAKALDLARQHVGDVSRWEELVWELPAVVEEVP
Ga0075432_1004106423300006058Populus RhizosphereVERYVVTTRIKPGSAPAVEELLSAGPPFDPGDAGLSAHSAYLSDDRVFLVFEGEAARAKALDLARQHMGDVSRWEELVWELPAVVEEVPATARCVYGWQAPR*
Ga0074055_1167634013300006573SoilMERYVVATRLKPGASSAAEELLSAGPPFDPGEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0074053_1157107213300006575SoilMERYVVATRLKPGAAPAAEELLAAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0074047_1183660313300006576SoilMERYVVATRLKPGAAPAAEELLAAGPPFDPGEAGLSAHAAYISNDSVFLVFEGEAAHATALQLARKHVVEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0074054_1193205713300006579SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0074048_1269400013300006581SoilMERYVVTTRLKPGAAPAAEELLLAGPPFDPGKAGLSAHAAYLSDDRVFLVFEGDAARAKALGLAKQYMVEVGRWQELVWELPSVTDDVPADARCLYRWPVEQVRT*
Ga0075431_10006384323300006847Populus RhizosphereVERYVVTTRIKPGSAPTVEELLSAGPPFDPGDAGLSAHSAYLSDDRVFLVFEGEAARAKALDLARQHMGDVSRWEELVWELPAVVEEVPATARCVYGWQAPR*
Ga0068865_10039689933300006881Miscanthus RhizosphereMERYVVATRLKPGAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHLIEVSRWQDIVWELPSAIADVPADARCLYRWPPSSESPT*
Ga0075435_10008686443300007076Populus RhizosphereVERYVVTTRIKPGSAPAVEELLSAGPPFDPGDAGLSAHSAYLSDDRVFLVFEGEAARAKALDLARQHVGDVSRWEELVWELPAVVEEVPATARCVYGWQAPR*
Ga0105248_1143844733300009177Switchgrass RhizosphereMERYVVATRLKPGAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHLIEVSRWQDIVWELPSVIADVPADARCLYRWP
Ga0126384_1007815223300010046Tropical Forest SoilMERYVVTTRLKPGATHAAEDLLSQGPPFDPAEAGLSAHAAYLTDDRVFLVFEGEAAHATALSLAKRHVIEVTQWQELVWELPSVVGDVPPDARCLYRWPEPPLSVTP*
Ga0138513_10005471223300011000SoilMERYVVATRLKPGAATAAEELLSAGPPFDPGETGLSAHAAYLSNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0138514_10007691623300011003SoilMATILQEANMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDRVFLVFEGETAHATALQLAKKHVVEVSRWHDIVWELPSVIAEVPADARCLYRWPVDRPE*
Ga0162653_10006157523300012937SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGETAHAIALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0162650_10003769313300012939SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGETGLSAHAAYIGNDSVFLVFEGDAAHATALQLAKKHLVEVSRWQDIVWELPSVIAEVPADARCVYRWPVDRSDTGG*
Ga0157375_1140021633300013308Miscanthus RhizosphereMERYVVATRLKPGAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEAEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE*
Ga0163163_1107183913300014325Switchgrass RhizosphereMERYVVTTRLKPGAAPAAEELLLAGPPFDPAGAGLSAHAAYLGGDRVFLVFEGDAAHAKALALAKQYVVEVSRWEDLVWELPAVVDDVPANARCVYRWPALTRSSLE*
Ga0132258_1361402513300015371Arabidopsis RhizosphereLKPGATHAAEELLSAGPPFDPGAAGLSAHAAYLGDDRVFLVFEGDEAREKALELGKRYADEVTQWQELVWELPSVVDEVPASARCLYRWPADDLCSPGGGAAPDAGDA*
Ga0132257_10002954833300015373Arabidopsis RhizosphereMERYVVTTRLKPGATRAAEELLSLGPPFDPGEAGLTAHAAYLADDRVFLVFEGDAAHAKALDLAKRHASEVSRWQDLVWELPSIVEDVPSAARCLYQWRAATP*
Ga0184605_1005126723300018027Groundwater SedimentMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYGWPVDRSE
Ga0184608_1023483113300018028Groundwater SedimentMERYVVATRLKPGAAPAALELLSAGPPFDPGETGLSAHAAYISDDRVFLVFEGEAAHATALQLAKEHVLEVSRWQDIVWELPSVIADVPADARCLYRWPADRSE
Ga0184621_1000490953300018054Groundwater SedimentMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYGWPVDRSE
Ga0184621_1002157623300018054Groundwater SedimentMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRG
Ga0184619_1027215813300018061Groundwater SedimentMERYVVATRLKPGAAPAAEELLSEGPPFDPGETGLSAHAAYLSNDSVFLVFEGEAAHATALQLAKKHVLEVSRWQDIVWELPSVIADVPADARCLYRWPADRSE
Ga0184619_1037788513300018061Groundwater SedimentMATILQEAYMERYVVATRLKPGAAPAAEELLSAGPPFDPGETGLSAHAAYISNDRVFLVFEGETAHGTALQLAKKYVVEVSRWQDIVWELPSVIAE
Ga0184611_125584613300018067Groundwater SedimentMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0184635_1039749223300018072Groundwater SedimentMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVP
Ga0184640_1029145823300018074Groundwater SedimentMERYVVATRLKPGAASAAEESLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKKHVVEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0184609_1035970823300018076Groundwater SedimentMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0193700_106743523300019873SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLY
Ga0193701_100423273300019875SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVTTDVPADARCLYRWPVDRSE
Ga0193701_101191113300019875SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIA
Ga0193725_108917413300019883SoilRYVVATRLKPGAALAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0193747_100265933300019885SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATTLQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYGWPVDRSE
Ga0193727_100614743300019886SoilMERYVVATRLKPGAALAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0193731_107975913300020001SoilVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYGWPVDRSE
Ga0193730_107858023300020002SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0193697_112271213300020005SoilMERYVVATRLKPGAAPTAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPAD
Ga0193732_106869723300020012SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIAD
Ga0210378_1007242823300021073Groundwater SedimentMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYGWPVDRSE
Ga0210382_1056857713300021080Groundwater SedimentAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYGWPVDRSE
Ga0222623_1021176913300022694Groundwater SedimentRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0207686_1026859913300025934Miscanthus RhizosphereMERYVVATRLKPGAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHLIEVSRWQDIVWELPSAIADVPADARCLYRWPPSSESPT
Ga0207661_1053055523300025944Corn RhizosphereMERYVVTTRLKPGAAPAAEELLLAGPPFDPAGAGLSAHAAYLGGDRVFLVFEGDAAHAKALALAKQYVVEVSRWEDLVWELPAVVDDVPADARCVYRWPALARSRLE
Ga0207702_1068302813300026078Corn RhizosphereMERYVVTTRLKPGAAPAAEELLLAGPPFDPAGAGLSAHAAYLGGDNVFLVFEGDAAHAKALALAKQYVVEVSRWEDLVWELPAVVDDVPADARCVYRWPALARSRL
Ga0207683_1077735523300026121Miscanthus RhizosphereMERYVVATRLKPGAAPAAEELLSAGPPFDPAEAGLSAHAAYISNDHVFLVFEGEAAHATALQLAKEHLIEVSRWQDIVWELPSVIADVPADARCLYRWQIDRG
Ga0209465_1043477123300027874Tropical Forest SoilMERYVVTTRLKPGAAHAAEELLSQGPPFDPAEAGLSAHAAYLTDDRVFLMFEGEAAHATALSLAKQHVIEVSQWQELVWELPSVVGDVPPDARCLYRWPEPPLSVTP
Ga0209382_1016594843300027909Populus RhizosphereVERYVVTTRIKPGSAPAVEELLSAGPPFDPGDAGLSAHSAYLSDDRVFLVFEGEAARAKALDLARQHVGDVSRWEELVWELPAVVEEVPATARCVYGWQAPR
Ga0307303_1010693513300028713SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRG
Ga0307309_1002770913300028714SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVTADVPADARCLYRWP
Ga0307311_1005977013300028716SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPA
Ga0307298_1002486213300028717SoilPYSPILQEAHMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVTTDVPADARCLYRWPVDRSE
Ga0307317_1015207223300028720SoilVATRLKPGAAPAALELLSAGPPFDPGETGLSAHAAYISDDRVFLVFEGEAAHATALQLAKEHVLEVSRWQDIVWELPSVIADVPADARCLYRWPADRSE
Ga0307280_1003418843300028768SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRG
Ga0307280_1031092613300028768SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYHWPVDRSE
Ga0307282_1003023453300028784SoilMSTILQGAHMERHVVAARLKPGAAPAAEELLSEGPPFDPGETGLSAHAAYLSNDSVFLVFEGEAAHATALQLANEHVVEVSRWQNIVWELPSVVADVPADARCLYRWPVDRSE
Ga0307282_1014862013300028784SoilMERYVVATRLKPGAAPAAEELLSAGPPFNPGETGLSAHAAYISDDSVFLVFEGEAAHATALQLAKKHVLEVSRWQDIVWELPSVIADVPADARCLYRWSADRSE
Ga0307281_1010734413300028803SoilMERYVVTTRLKPGAAPAAEELLSAGPPFNPGETGLSAHAAYISDDRVFLVFEGEAAHATALQLAKKHVLEVSRWQDIVWELPSMIADVPADARCLYRWPVDRSE
Ga0307305_1002487333300028807SoilMDRYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVTTDVPADARCLYRWPVDRSE
Ga0307305_1018276013300028807SoilMERYVVTTRLKPGAAPAAEELLSAGPPFNPGETGLSAHAAYISDDSVFLVFEGEAAHATALQLAKKHVLEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0307312_1039686613300028828SoilMERYVVTTRLKPGAAPAAEELLSAGPPFNPGETGLSAHAAYISDDSVFLVFEGEAAHATALQLAKKHVLEVSRWQDIVWELPSVIADVPADARCLYRWSADRSE
Ga0307289_1000148523300028875SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVTADVPADARCLYRWPGQSVGITCVLTGVAVDRDLLT
Ga0307278_1000486743300028878SoilMERYVVATRLKRGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIAEVPADARCLYRWPVDRPE
Ga0307278_1003641623300028878SoilMERYVVATRLKPGAAPAAEELLAAGPPFDPGEAGLSAHAAYISNDSVFLVFEGEAAHATALQLAKKHVVEVSRWQDIVWELPSVIADVPADARCLYRWPVDPSE
Ga0307277_1008048923300028881SoilMERYVVTTRLKPGAAPAAEELLSAGPPFNPGETGLSAHAAYISDDSVFLVFEGEAAHATALQLAKKHVLEVSRWQDIVWELPSLIADVPADARCLYRWPVDRSE
Ga0307304_1007489723300028885SoilHMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVTADVPADARCLYRWPLDRSE
Ga0308202_104982733300030902SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIA
Ga0308206_114626413300030903SoilMERYVVATRLKPGAAPAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYGWPVDRSE
Ga0308178_116789313300030990SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVTTDVPADAR
Ga0308201_1029922113300031091SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRG
Ga0308197_1028756123300031093SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIAEVPADARCLYRWPVDRSE
Ga0307498_1000255723300031170SoilMERYVVATRLKPGAAAAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVTEVSRWQDIVWELPSVIADVPVDARCLYRWPIDRSE
Ga0307498_1013569813300031170SoilMERYVVTTRLKPGAAPAAEELLSAGPPFDPGEEGLSAHAAYISSDRVFFVFEGETAHATALQLAKTHVVEVSRWQDIVWELPSVIAE
Ga0307498_1014983523300031170SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLVFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPIDRSE
Ga0307498_1041901113300031170SoilPGAAAAAEELLSAGPPFDPGEAGLSAHAAYISNDYVFLAFEGEAAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVDRSE
Ga0307497_1031975323300031226SoilRLKPGAAPAAEELLSAGPPFDPGEEGLSAHAAYISSDRVFFVFEGETAHATALQLAKTHVVEVSRWQDIVWELPSVIAEVPADARCLYRWPVNQSDQAGASASESPPIS
Ga0308194_1024128713300031421SoilMERYVVATRLKPGAASAAEELLSAGPPFDPGEAGMSAHAAYISNDYVFLVFEGETAHATALQLAKEHVIEVSRWQDIVWELPSVIADVPADARCLYRWPVGRSE
Ga0310813_1061735623300031716SoilVTTRVKPGAAPAAEELLLEGPPFDPGEAGLSAHEAYLTDDRIYLVFEGEAAQAKALALAKQHIAEVSRWEVLLWELPSTVEDVPATARCLYRWP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.