Basic Information | |
---|---|
Family ID | F101107 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 44 residues |
Representative Sequence | MPVGLVIIIAVVMALAVPRIRLRLPVPDASRRARSLAWRLRMRQR |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 49.02 % |
% of genes near scaffold ends (potentially truncated) | 50.00 % |
% of genes from short scaffolds (< 2000 bps) | 83.33 % |
Associated GOLD sequencing projects | 76 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.784 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.569 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF12802 | MarR_2 | 12.75 |
PF01590 | GAF | 8.82 |
PF13549 | ATP-grasp_5 | 2.94 |
PF13466 | STAS_2 | 2.94 |
PF00487 | FA_desaturase | 1.96 |
PF00291 | PALP | 1.96 |
PF13374 | TPR_10 | 0.98 |
PF01548 | DEDD_Tnp_IS110 | 0.98 |
PF03279 | Lip_A_acyltrans | 0.98 |
PF00011 | HSP20 | 0.98 |
PF01047 | MarR | 0.98 |
PF02954 | HTH_8 | 0.98 |
PF13439 | Glyco_transf_4 | 0.98 |
PF01458 | SUFBD | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.96 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.96 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.98 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.78 % |
Unclassified | root | N/A | 39.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101802502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 513 | Open in IMG/M |
3300004080|Ga0062385_10343083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
3300004082|Ga0062384_100384163 | Not Available | 900 | Open in IMG/M |
3300004092|Ga0062389_103695709 | Not Available | 574 | Open in IMG/M |
3300005169|Ga0066810_10089041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300005434|Ga0070709_10011976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4847 | Open in IMG/M |
3300005435|Ga0070714_100164660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2009 | Open in IMG/M |
3300005445|Ga0070708_100070195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3151 | Open in IMG/M |
3300005445|Ga0070708_100842588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 861 | Open in IMG/M |
3300005467|Ga0070706_100628294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 997 | Open in IMG/M |
3300005468|Ga0070707_101522303 | Not Available | 636 | Open in IMG/M |
3300006034|Ga0066656_10768175 | Not Available | 618 | Open in IMG/M |
3300006577|Ga0074050_11889906 | Not Available | 564 | Open in IMG/M |
3300006797|Ga0066659_11142318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
3300006953|Ga0074063_14145986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 642 | Open in IMG/M |
3300009038|Ga0099829_10122587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2048 | Open in IMG/M |
3300009038|Ga0099829_11725816 | Not Available | 514 | Open in IMG/M |
3300009088|Ga0099830_11566376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300009089|Ga0099828_10457005 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300009090|Ga0099827_10081766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2524 | Open in IMG/M |
3300009090|Ga0099827_10399413 | Not Available | 1175 | Open in IMG/M |
3300009520|Ga0116214_1346271 | Not Available | 575 | Open in IMG/M |
3300009683|Ga0116224_10285048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 787 | Open in IMG/M |
3300009762|Ga0116130_1293424 | Not Available | 519 | Open in IMG/M |
3300009824|Ga0116219_10479313 | Not Available | 689 | Open in IMG/M |
3300010154|Ga0127503_10372843 | Not Available | 646 | Open in IMG/M |
3300010333|Ga0134080_10547814 | Not Available | 556 | Open in IMG/M |
3300010379|Ga0136449_100382877 | Not Available | 2508 | Open in IMG/M |
3300010379|Ga0136449_102013945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 852 | Open in IMG/M |
3300010379|Ga0136449_103673841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 580 | Open in IMG/M |
3300010862|Ga0126348_1211102 | Not Available | 541 | Open in IMG/M |
3300011120|Ga0150983_10132618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 794 | Open in IMG/M |
3300011120|Ga0150983_10682083 | Not Available | 1234 | Open in IMG/M |
3300011120|Ga0150983_15647689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus albus | 694 | Open in IMG/M |
3300011270|Ga0137391_10216574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 1664 | Open in IMG/M |
3300011271|Ga0137393_10548827 | Not Available | 991 | Open in IMG/M |
3300012096|Ga0137389_10208397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
3300012198|Ga0137364_11132997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
3300012201|Ga0137365_10084964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2383 | Open in IMG/M |
3300012202|Ga0137363_10814199 | Not Available | 792 | Open in IMG/M |
3300012206|Ga0137380_10108193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 2540 | Open in IMG/M |
3300012206|Ga0137380_10205509 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300012206|Ga0137380_11054270 | Not Available | 694 | Open in IMG/M |
3300012207|Ga0137381_10458094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
3300012209|Ga0137379_10109344 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
3300012350|Ga0137372_10142983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1961 | Open in IMG/M |
3300012917|Ga0137395_10744822 | Not Available | 709 | Open in IMG/M |
3300012927|Ga0137416_11724060 | Not Available | 572 | Open in IMG/M |
3300013770|Ga0120123_1055916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
3300014491|Ga0182014_10393199 | Not Available | 693 | Open in IMG/M |
3300015374|Ga0132255_102347739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 814 | Open in IMG/M |
3300016341|Ga0182035_10511398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1027 | Open in IMG/M |
3300017926|Ga0187807_1186411 | Not Available | 670 | Open in IMG/M |
3300018037|Ga0187883_10627291 | Not Available | 559 | Open in IMG/M |
3300019879|Ga0193723_1127595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
3300019879|Ga0193723_1176569 | Not Available | 552 | Open in IMG/M |
3300019888|Ga0193751_1015841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3833 | Open in IMG/M |
3300019888|Ga0193751_1023498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2997 | Open in IMG/M |
3300020078|Ga0206352_10216523 | Not Available | 546 | Open in IMG/M |
3300020580|Ga0210403_10558565 | Not Available | 927 | Open in IMG/M |
3300020581|Ga0210399_10109080 | Not Available | 2269 | Open in IMG/M |
3300021402|Ga0210385_10920562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 671 | Open in IMG/M |
3300021405|Ga0210387_11008134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 729 | Open in IMG/M |
3300021407|Ga0210383_11605876 | Not Available | 535 | Open in IMG/M |
3300021432|Ga0210384_11789936 | Not Available | 520 | Open in IMG/M |
3300022512|Ga0242676_1054028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300022532|Ga0242655_10248318 | Not Available | 562 | Open in IMG/M |
3300023551|Ga0247546_103306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 626 | Open in IMG/M |
3300025434|Ga0208690_1057816 | Not Available | 605 | Open in IMG/M |
3300025910|Ga0207684_10033328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4380 | Open in IMG/M |
3300025916|Ga0207663_10646499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 834 | Open in IMG/M |
3300025922|Ga0207646_10026088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5339 | Open in IMG/M |
3300025922|Ga0207646_10043148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4051 | Open in IMG/M |
3300025922|Ga0207646_10551568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 1036 | Open in IMG/M |
3300025922|Ga0207646_11045467 | Not Available | 720 | Open in IMG/M |
3300025928|Ga0207700_10995655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 750 | Open in IMG/M |
3300027297|Ga0208241_1044741 | Not Available | 697 | Open in IMG/M |
3300027568|Ga0208042_1018776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1786 | Open in IMG/M |
3300027655|Ga0209388_1160256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
3300027698|Ga0209446_1198634 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300027750|Ga0209461_10139877 | Not Available | 581 | Open in IMG/M |
3300027825|Ga0209039_10083923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1387 | Open in IMG/M |
3300027829|Ga0209773_10093886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1235 | Open in IMG/M |
3300027846|Ga0209180_10629424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
3300027889|Ga0209380_10245227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 1052 | Open in IMG/M |
3300028047|Ga0209526_10597003 | Not Available | 708 | Open in IMG/M |
3300028801|Ga0302226_10327650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 644 | Open in IMG/M |
3300028807|Ga0307305_10084202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1470 | Open in IMG/M |
3300028828|Ga0307312_10741247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 651 | Open in IMG/M |
3300030499|Ga0268259_10167104 | Not Available | 531 | Open in IMG/M |
3300030707|Ga0310038_10353393 | Not Available | 649 | Open in IMG/M |
3300031226|Ga0307497_10033456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Allosalinactinospora → Allosalinactinospora lopnorensis | 1695 | Open in IMG/M |
3300031708|Ga0310686_103056943 | Not Available | 565 | Open in IMG/M |
3300031720|Ga0307469_11713449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300031723|Ga0318493_10794518 | Not Available | 533 | Open in IMG/M |
3300032160|Ga0311301_10409531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2070 | Open in IMG/M |
3300032160|Ga0311301_10419578 | Not Available | 2036 | Open in IMG/M |
3300032160|Ga0311301_10497032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1810 | Open in IMG/M |
3300032160|Ga0311301_10543139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1702 | Open in IMG/M |
3300032160|Ga0311301_11353873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 893 | Open in IMG/M |
3300032261|Ga0306920_101570353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 937 | Open in IMG/M |
3300034819|Ga0373958_0118942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 637 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.57% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.98% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1018025021 | 3300002245 | Forest Soil | VGVATAIAVVIVLTVPRIRLRVPVPVASRRTRSLVRRLRMWNR* |
Ga0062385_103430832 | 3300004080 | Bog Forest Soil | MVITIAVEMALGVPRVRLRLSVPDAGRRARLLAWRLRMGQR* |
Ga0062384_1003841631 | 3300004082 | Bog Forest Soil | VGAHAGGLAIAIAIAVVMALAVPRIRLKLSVPVAYRRARSLAWRLRMRNR* |
Ga0062389_1036957091 | 3300004092 | Bog Forest Soil | LAIAIAAVMALAVPRIRLRQPVPVASRLARSLARRLRMRNR* |
Ga0066810_100890411 | 3300005169 | Soil | MPIGLIIIVAVVMALAGPRMRLTLSVPDASHRARSLAWRLRMRQR* |
Ga0070709_100119766 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAGLVTILAVFMALGMPRTRLRPPVPDASRRARSLAWRLWMRQR* |
Ga0070714_1001646604 | 3300005435 | Agricultural Soil | MPAGLAIAIAVVMALAGPRIRLRLPVPVASRRASSLAWRMRDR* |
Ga0070708_1000701954 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIGLVIIMAVVMALGMPRLRLRLPVPDASRLARSLAWRLRMLQQ* |
Ga0070708_1008425883 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPGLIIIMAVLMALAAPRSRLGLPVPDAGRRARFLAWRPRMRQP* |
Ga0070706_1006282942 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPGLIIIMAVLMALAVPRSRLGLPVPDAGRRARFLAWRPRMRQP* |
Ga0070707_1015223031 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVGLIIIAAVLMALGMPRSRLSLPVPDASRRAGSLAWRLRMRQR* |
Ga0066656_107681752 | 3300006034 | Soil | MTLAVVMALAVPRIRLRLPVPVARRRARPLGLAAA |
Ga0074050_118899062 | 3300006577 | Soil | MPIGLIIIVAVVMALAGPRMRLTLSVPDASRRARSLAWRLRMRQR* |
Ga0066659_111423181 | 3300006797 | Soil | MPPGLVIIVAVLMALAVQLIRLRPLVPDASRRARPLAWRLRMRQR* |
Ga0074063_141459862 | 3300006953 | Soil | MPAGMVIAIAVEMALGKPRVRLRLSVPDARRRARLLAWRLRMRR* |
Ga0099829_101225872 | 3300009038 | Vadose Zone Soil | MPAGLVIIVAVLMALAVPRSRLGLPVPDAGRRARSVAWRLRMRQR* |
Ga0099829_117258161 | 3300009038 | Vadose Zone Soil | MPAGMVITIAVEMALAVPRIRLRLSVPDASRRARSLAWRLRMRQEVTR* |
Ga0099830_115663762 | 3300009088 | Vadose Zone Soil | MPVGLVTIVAVLMALAVPRSRLGLPVPDAGRRARSVAWRLRMRQR* |
Ga0099828_104570053 | 3300009089 | Vadose Zone Soil | MPAGMVITIAVEMALAVPRIRLRLSVPDASRRARSLAWRLRMRR |
Ga0099827_100817662 | 3300009090 | Vadose Zone Soil | MPIGLVTIMAVLMALAVPRSRLGLPVPDVSRRARSLAWRLRRRQR* |
Ga0099827_103994131 | 3300009090 | Vadose Zone Soil | MPIGLIIIMAVLMALAVPRSRLRPPVPDAGRRARSLAWRLRMRQR* |
Ga0116214_13462712 | 3300009520 | Peatlands Soil | AVVMALAVPRIRLRLPVPVASRRARSLAWRLRMWNR* |
Ga0116224_102850481 | 3300009683 | Peatlands Soil | AGAHAAGLAIAVAVGTALAVPRIRLRLSVPVASRRARSLAWRLRMRNR* |
Ga0116130_12934242 | 3300009762 | Peatland | LPSALAIAIAAVIALAVPRIRLKPVPVASRRARSLARRLRMGNR* |
Ga0116219_104793132 | 3300009824 | Peatlands Soil | AADLVIAIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMWNR* |
Ga0127503_103728432 | 3300010154 | Soil | IAIAVVMALAGPRIRLRLLVPVASRRARSLAWRLRERER* |
Ga0134080_105478141 | 3300010333 | Grasslands Soil | TGLVIAIAVVMALAGPRIRLRLLVPVASRRARSLAWRLRMRRR* |
Ga0136449_1003828772 | 3300010379 | Peatlands Soil | MPTGQMTIMAVLVALILPRIRLRLPVPDASRRARSLAWRLRTRQR* |
Ga0136449_1020139453 | 3300010379 | Peatlands Soil | GLAIAIAVVMALAVPHIRLRLSVPVASRRARPLAWRLRMRNR* |
Ga0136449_1036738411 | 3300010379 | Peatlands Soil | GATAGAHAAGLAIVIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR* |
Ga0126348_12111022 | 3300010862 | Boreal Forest Soil | MPIGLIIITAVLMALGMPRLRLRPPVPMQAAGPDLFLAWRLRMRQR* |
Ga0150983_101326182 | 3300011120 | Forest Soil | GLAIAIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR* |
Ga0150983_106820833 | 3300011120 | Forest Soil | MRTGLGIIVVVVTALTVPRIRLTPSVPGASRRARSLARRLWMRQR* |
Ga0150983_156476893 | 3300011120 | Forest Soil | GLPEERMRTGLGIIVVVVTALTVPRIRLTPSVPGASRRARSLARRLRMRQR* |
Ga0137391_102165741 | 3300011270 | Vadose Zone Soil | MPIGLVTIMAVLMALAVPRSRLGLPVPDAGRRARSVAWRLRMRQR* |
Ga0137393_105488271 | 3300011271 | Vadose Zone Soil | MPIGLIMIMAVFMALGMPRSSRLSLPVPDASRRAGSLAWRLRMRKR* |
Ga0137389_102083971 | 3300012096 | Vadose Zone Soil | VPVGLIIIVAVLMALAVPRSRLGLPVPDAGRRARSVAWRLRMRQR* |
Ga0137364_111329972 | 3300012198 | Vadose Zone Soil | MPAGLIIIMAVLMALGMPRSRLRPPVPDASRRARSLAWRQR* |
Ga0137365_100849644 | 3300012201 | Vadose Zone Soil | MPVGLVTIMAVLMALAVPRTRLRPPVPDASRRARSLAWRLRMRQR* |
Ga0137363_108141991 | 3300012202 | Vadose Zone Soil | WPSLMALGMPRSRLSLPVPDASRRAGSLAWRLRMRKR* |
Ga0137380_101081934 | 3300012206 | Vadose Zone Soil | MPPGLVIIVAALMALAVQLIRLGPPVPDAGRRARSLAWRPRMRQP* |
Ga0137380_102055091 | 3300012206 | Vadose Zone Soil | IMAVLMALAVPRTRLRPPVPDASRRARSLAWRLRMRLR* |
Ga0137380_110542701 | 3300012206 | Vadose Zone Soil | MPAGLVIIVAVLMALGMPRIRLRPSVPDAGRRARPLAWRLRMRQR* |
Ga0137381_104580942 | 3300012207 | Vadose Zone Soil | MPPGLIIIVAVLVALAVQLIRLGPPVPDAGRRARSLAWRPRMRQP* |
Ga0137379_101093445 | 3300012209 | Vadose Zone Soil | MPAGMVIAIAVEMALGKPRGRLRLSVPDASRRARLLAWRLRMGQR* |
Ga0137372_101429833 | 3300012350 | Vadose Zone Soil | MPAGLVTIMAVLMALAVPRTRLRPPVPDASRRARSLAWRLRMRLR* |
Ga0137395_107448221 | 3300012917 | Vadose Zone Soil | SSWPSLMALGMPRSRLSLPVPDASRRAGSLAWRLRMRKR* |
Ga0137416_117240602 | 3300012927 | Vadose Zone Soil | MPVGLIIIWPSLMALGMPRSRLSLPVPDASRRAGSLAWRLRMRKR* |
Ga0120123_10559161 | 3300013770 | Permafrost | MLIGLIIIMAVEMALGMPHIRLSLPVPDASRRARSLAWRLRMRQR* |
Ga0182014_103931991 | 3300014491 | Bog | MPVGLVIIIAVVMALAVPRIRLRLPVPDASRRARSLAWRLRMRQR* |
Ga0132255_1023477391 | 3300015374 | Arabidopsis Rhizosphere | HAVGLVIAIAVVMALAVPRIRLRLSVPVASRRARSLAWRLRMRNR* |
Ga0182035_105113981 | 3300016341 | Soil | IAVVVALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0187807_11864111 | 3300017926 | Freshwater Sediment | AGLVIVIAMVMALAVPRIRLRPPVPVASRRAWSLAWRLRMRNR |
Ga0187883_106272911 | 3300018037 | Peatland | MPVGLVIIIAVVMALAVPRIRLRLPVPDASRRARSLAWRLRMRQR |
Ga0193723_11275952 | 3300019879 | Soil | MLPGLVIIVAVLMALGMPRTRLRPSVPDASRRARPLAWRLRMRQR |
Ga0193723_11765693 | 3300019879 | Soil | VGLATAIAVVMALAVPRIRLRLSVPVASRRARSLARRLRIRNR |
Ga0193751_10158412 | 3300019888 | Soil | MPAGMVITIAAGRALAMPHIRLRPPVPDASRRARSLAWRLRMRQR |
Ga0193751_10234983 | 3300019888 | Soil | MPPGLVIIVAVLMALGMPRTRLRPSVPDASRRARPLAWRLRMRQR |
Ga0206352_102165232 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MALAVPRIRLRLSVPVASRRARSLAWRLRMRTGDTMK |
Ga0210403_105585652 | 3300020580 | Soil | PAGLVTILAVFMALGMPRTRLRPPVPDASRRARSLAWRLWMRQR |
Ga0210399_101090802 | 3300020581 | Soil | MRTGLGIIVVVVTALTVPRIRLTPSVPGASRRARSLARRLRMRQR |
Ga0210385_109205621 | 3300021402 | Soil | AIAIAAVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0210387_110081342 | 3300021405 | Soil | GAHAAGLAIAIAVVTALAVPRIRLRLPVPVASRRARSLAWRLRMRNW |
Ga0210383_116058762 | 3300021407 | Soil | IFVVVVTALTVPRIRLTPSVPGASRRARSLARRLRMRQR |
Ga0210384_117899363 | 3300021432 | Soil | IAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0242676_10540282 | 3300022512 | Soil | MRTGLGIIVVVVTALTVPRIRLTPSVPGASRRARSLAWRLRMRRQ |
Ga0242655_102483181 | 3300022532 | Soil | GLPEEPMPAGMVIAIAVEMALGKPRVRLRLPVPDARRRARSLAWRRRMRPR |
Ga0247546_1033063 | 3300023551 | Soil | GLAIAIAVVMVLVVPRIRMRLPVPVASRRARSLAWRLRMRKPVTR |
Ga0208690_10578161 | 3300025434 | Peatland | LPSALAIAIAAVIALAVPRIRLKPVPVASRRARSLARRLRMGNR |
Ga0207684_100333286 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIGLVIIMAVVMALGRPRLRLRLPVPDASRRARFLAWRLRMRQR |
Ga0207663_106464992 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TAGAHAAGLAIAIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0207646_100260882 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIGLVIIMAVVMALGMPRLRLRLPVPDASRLARSLAWRLRMLQQ |
Ga0207646_100431481 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LVIAIAVVMALAVPRIRLRLSVPVASRRARSLAWRLRMRNW |
Ga0207646_105515683 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAGLAIAIAVVMALAGPRIRLRLPVPVASRRASSLAWRMRDR |
Ga0207646_110454672 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVGLIIIAAVLMALGMPRSRLSLPVPDASRRAGSLAWRLRMRQR |
Ga0207700_109956552 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLAIAIAVVMALAGPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0208241_10447412 | 3300027297 | Forest Soil | MAIAAVMALAVPRVRVRLSVPVASRRARSLAWRLR |
Ga0208042_10187762 | 3300027568 | Peatlands Soil | PGATAGAHAAGLAIVIAVVMALAVPRIRLRLPVPVASRQARSLAWRLRMWNR |
Ga0209388_11602562 | 3300027655 | Vadose Zone Soil | MPPGLVIIVAVLMALAVQLIRLRPLVPDASRRARPLAWRLRMRQR |
Ga0209446_11986341 | 3300027698 | Bog Forest Soil | MVITIAVEMALGVPRVRLRLSVPDAGRRARLLAWRLRMGQR |
Ga0209461_101398771 | 3300027750 | Agave | NAIAVVMALAVSRIRLRLSVPVASRRARSPAWRLRMWKR |
Ga0209039_100839231 | 3300027825 | Bog Forest Soil | MAVLMARALPRSRLRPSVPDASRRARSLAWRLRMRRR |
Ga0209773_100938862 | 3300027829 | Bog Forest Soil | VGAHAGGLAIAIAIAVVMALAVPRIRLKLSVPVAYRRARSLAWRLRMRNR |
Ga0209180_106294242 | 3300027846 | Vadose Zone Soil | MPAGLVIIVAVLMALAVPRSRLGLPVPDAGRRARSVAWRLRMRQR |
Ga0209380_102452273 | 3300027889 | Soil | TAGAPAAGLVIAIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0209526_105970031 | 3300028047 | Forest Soil | VHTAGLVIAIAAVMALAVPRIRLRLPVPVASRRARSLAWRLR |
Ga0302226_103276501 | 3300028801 | Palsa | RPPGLAIAIAVLMALAVPRIRLRLPVPVASRLARSLARRLRMRNR |
Ga0307305_100842022 | 3300028807 | Soil | AASYPGLPEERMPPGLVIIVAVLMALGMPRTRLRPSVPDASRRARPLAWRLRMRQR |
Ga0307312_107412472 | 3300028828 | Soil | GLAIAIAVVMALALPRIRLRLSVPVASRRTRSLAWRLRMWER |
Ga0268259_101671041 | 3300030499 | Agave | AVVMALAVSRIRLRLSVPVASRRARSPAWRLRMWKR |
Ga0310038_103533931 | 3300030707 | Peatlands Soil | GATAGAHAAGLAIAIAVVMALAVPRIRLRLPVPVASRRARSLTWRLRMRNR |
Ga0307497_100334561 | 3300031226 | Soil | TPTGLVIAIAVVMALAVPRIRLRLSVPVASRRARSLAWRLRMWDR |
Ga0310686_1030569431 | 3300031708 | Soil | AIAIAVVMALAVPRIRLRLSVPVASRRARSLAWRLRMRNR |
Ga0307469_117134491 | 3300031720 | Hardwood Forest Soil | MALAVPRIRLRLSVPVASRRARSLAWRLRMRTGDTMKD |
Ga0318493_107945183 | 3300031723 | Soil | PEERTPTGLVIAVVVALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0311301_104095312 | 3300032160 | Peatlands Soil | GLAIVIAVVMALAVPRIRLRLPVPVASRQARSLAWRLRMWNR |
Ga0311301_104195783 | 3300032160 | Peatlands Soil | MPTGQMTIMAVLVALILPRIRLRLPVPDASRRARSLAWRLRTRQR |
Ga0311301_104970323 | 3300032160 | Peatlands Soil | RTPAGLAIAIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
Ga0311301_105431391 | 3300032160 | Peatlands Soil | AVVMALAVPRIRLRLPVPVAIRRARSLAWRLRMRNR |
Ga0311301_113538731 | 3300032160 | Peatlands Soil | GLAIAIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMWNR |
Ga0306920_1015703532 | 3300032261 | Soil | ERTPTGLVIAIAGVMALVVSRIRLRLSVPVVSRRARSLAWRLRMRDR |
Ga0373958_0118942_1_117 | 3300034819 | Rhizosphere Soil | AIAVVMALAVPRIRLRLPVPVASRRARSLAWRLRMRNR |
⦗Top⦘ |