NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100889

Metagenome / Metatranscriptome Family F100889

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100889
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 54 residues
Representative Sequence TKYSTIILDGGPVDPADSIVIGVNQAQRVNSDAWWRADLQPAAEAAVPRKKP
Number of Associated Samples 97
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.98 %
% of genes near scaffold ends (potentially truncated) 92.16 %
% of genes from short scaffolds (< 2000 bps) 92.16 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.275 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.823 % of family members)
Environment Ontology (ENVO) Unclassified
(37.255 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 10.00%    Coil/Unstructured: 70.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13709DUF4159 9.80
PF02687FtsX 3.92
PF11219DUF3014 2.94
PF08241Methyltransf_11 2.94
PF01436NHL 1.96
PF135322OG-FeII_Oxy_2 1.96
PF13620CarboxypepD_reg 1.96
PF04519Bactofilin 1.96
PF01381HTH_3 0.98
PF13185GAF_2 0.98
PF07676PD40 0.98
PF14534DUF4440 0.98
PF01799Fer2_2 0.98
PF01610DDE_Tnp_ISL3 0.98
PF12704MacB_PCD 0.98
PF00753Lactamase_B 0.98
PF02738MoCoBD_1 0.98
PF07366SnoaL 0.98
PF14333DUF4389 0.98
PF00596Aldolase_II 0.98
PF01927Mut7-C 0.98
PF00892EamA 0.98
PF03781FGE-sulfatase 0.98
PF00155Aminotran_1_2 0.98
PF02775TPP_enzyme_C 0.98
PF03795YCII 0.98
PF01557FAA_hydrolase 0.98
PF00072Response_reg 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 1.96
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.98
COG1656Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domainGeneral function prediction only [R] 0.98
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.98
COG3464TransposaseMobilome: prophages, transposons [X] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.27 %
UnclassifiedrootN/A13.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908006|FWIROz_GKA24FP02GHAKYAll Organisms → cellular organisms → Bacteria515Open in IMG/M
3300003321|soilH1_10027303All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300004081|Ga0063454_100527400All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300004114|Ga0062593_102699483All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300004463|Ga0063356_104225901All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300004463|Ga0063356_106335883Not Available507Open in IMG/M
3300004479|Ga0062595_102077356All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005328|Ga0070676_11307903All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005334|Ga0068869_101774734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300005338|Ga0068868_100568393All Organisms → cellular organisms → Bacteria → Acidobacteria1001Open in IMG/M
3300005338|Ga0068868_101889611All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005347|Ga0070668_101626130All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300005355|Ga0070671_101077070All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005438|Ga0070701_10304836All Organisms → cellular organisms → Bacteria → Acidobacteria980Open in IMG/M
3300005458|Ga0070681_10849498All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis831Open in IMG/M
3300005468|Ga0070707_101879526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300005471|Ga0070698_101632362All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300005532|Ga0070739_10512782All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300005549|Ga0070704_101623049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300005553|Ga0066695_10016036All Organisms → cellular organisms → Bacteria → Acidobacteria4084Open in IMG/M
3300005564|Ga0070664_101611731All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300005578|Ga0068854_100019763All Organisms → cellular organisms → Bacteria4546Open in IMG/M
3300005598|Ga0066706_11084892Not Available613Open in IMG/M
3300005713|Ga0066905_100487864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_151021Open in IMG/M
3300005719|Ga0068861_102244490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300005719|Ga0068861_102352492All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005844|Ga0068862_101639006All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006046|Ga0066652_101078605Not Available761Open in IMG/M
3300006755|Ga0079222_12235954All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300006796|Ga0066665_10371612All Organisms → cellular organisms → Bacteria → Acidobacteria1173Open in IMG/M
3300006852|Ga0075433_11125141All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006871|Ga0075434_100396998All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300006904|Ga0075424_100595095All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300006918|Ga0079216_10492072All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b806Open in IMG/M
3300009053|Ga0105095_10554658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300009093|Ga0105240_10549272All Organisms → cellular organisms → Bacteria → Acidobacteria1278Open in IMG/M
3300009100|Ga0075418_10032566All Organisms → cellular organisms → Bacteria5666Open in IMG/M
3300009100|Ga0075418_12761424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300009147|Ga0114129_12659100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300009148|Ga0105243_11020432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300009553|Ga0105249_13493887All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009610|Ga0105340_1480974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300010043|Ga0126380_10917428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis729Open in IMG/M
3300010399|Ga0134127_13023743All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300010403|Ga0134123_11126515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300011271|Ga0137393_10667104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29891Open in IMG/M
3300012189|Ga0137388_10623565All Organisms → cellular organisms → Bacteria → Proteobacteria1002Open in IMG/M
3300012349|Ga0137387_10874171All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300012360|Ga0137375_10556959Not Available963Open in IMG/M
3300012469|Ga0150984_123660707Not Available699Open in IMG/M
3300012958|Ga0164299_11192552All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012985|Ga0164308_10438665All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300012987|Ga0164307_11084864All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300013297|Ga0157378_12798622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300013307|Ga0157372_12881547All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis551Open in IMG/M
3300013308|Ga0157375_13495052All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300014326|Ga0157380_12337833All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300014883|Ga0180086_1026148Not Available1329Open in IMG/M
3300015371|Ga0132258_10429622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3289Open in IMG/M
3300016294|Ga0182041_12250469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300017959|Ga0187779_10956957All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300018031|Ga0184634_10349235All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae678Open in IMG/M
3300018075|Ga0184632_10487487All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21507Open in IMG/M
3300018082|Ga0184639_10535433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300018083|Ga0184628_10291469All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300018422|Ga0190265_12257453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300021080|Ga0210382_10505696All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300022309|Ga0224510_10546289Not Available686Open in IMG/M
3300022694|Ga0222623_10382648All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300025155|Ga0209320_10176204Not Available940Open in IMG/M
3300025311|Ga0209343_10400340All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300025326|Ga0209342_11204247All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300025327|Ga0209751_10050389All Organisms → cellular organisms → Bacteria3631Open in IMG/M
3300025327|Ga0209751_11020045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300025908|Ga0207643_10266265All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300025909|Ga0207705_10294541All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis1243Open in IMG/M
3300025913|Ga0207695_11180660All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300025929|Ga0207664_10014937All Organisms → cellular organisms → Bacteria → Proteobacteria5622Open in IMG/M
3300025935|Ga0207709_11273420All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300025940|Ga0207691_10702114All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300025949|Ga0207667_10238363All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300026023|Ga0207677_11125481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300026320|Ga0209131_1276838All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300027773|Ga0209810_1388792All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium503Open in IMG/M
3300027907|Ga0207428_11142434Not Available543Open in IMG/M
3300027908|Ga0209006_10755584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium792Open in IMG/M
3300028145|Ga0247663_1100843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300028802|Ga0307503_10678485All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300028803|Ga0307281_10300102All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300031114|Ga0308187_10406033Not Available539Open in IMG/M
3300031198|Ga0307500_10090610All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300031640|Ga0318555_10332667Not Available822Open in IMG/M
3300031893|Ga0318536_10047129Not Available2071Open in IMG/M
3300031940|Ga0310901_10585161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300031943|Ga0310885_10682821All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300032261|Ga0306920_103002883Not Available637Open in IMG/M
3300033412|Ga0310810_11310437All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300034150|Ga0364933_071143All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300034164|Ga0364940_0126063All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300034194|Ga0370499_0222991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300034690|Ga0364923_0056905All Organisms → cellular organisms → Bacteria → Acidobacteria934Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.94%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.94%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.98%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908006Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025311Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034194Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIROz_016929702124908006SoilMVLDGSSVEQGDSIVIGVNQAQRVSSDAWWRADLQAAAETRVPKKP
soilH1_1002730313300003321Sugarcane Root And Bulk SoilAHETKYSTLVLDGSPLEAGDTLVIGVNQAQRVGSDAWWRADLQPAAQALVEKKKE*
Ga0063454_10052740013300004081SoilARQVAPGRRALDARETKYSAMVLDGSPVEPGDVIVAGINQAQRVNSDAWWRADLQAAAEARVPRKP*
Ga0062593_10269948313300004114SoilTTKFSTIVLDGSTIAPTDQIVIGVNQAQRVNSEAWWRGDIQAAAEAAVKHTK*
Ga0063356_10422590123300004463Arabidopsis Thaliana RhizosphereLVVDGSPVEATDVIVIGINQAQHAGSTAWWRADLQRAAEAAVPLKKP*
Ga0063356_10633588323300004463Arabidopsis Thaliana RhizosphereDGTAIDPTDVIVIGINQVQQTGSDAWWRADLQPAAEAAVPLKK*
Ga0062595_10207735623300004479SoilTLKARQTAPGRRMLDPRGTKYSTLVLDGSEVDATDIVVVGVNQVQRVNSDAWWRADVQAAAEGLVPHKKP*
Ga0070676_1130790323300005328Miscanthus RhizosphereMVLDGSPVEPGDVIVAGINQAQRANSEAWWRADLQAAAEAKVPRKP*
Ga0068869_10177473423300005334Miscanthus RhizosphereTLDARSTKYSTLVLDGAPIDATDVVVVGVNQAQRADSEVWWRADLQTMAEAKQPKKP*
Ga0068868_10056839323300005338Miscanthus RhizosphereTKYSTLVLDGAPIDATDVVVVGVNQAQRADSEVWWRADLQTMAEAKQPKKP*
Ga0068868_10188961113300005338Miscanthus RhizosphereRRMLDPRGTKYSTLVLDGSEVDATDIVVVGVNQVQRVNSDTWWRADVQAAAEGLVPHKKP
Ga0070668_10162613013300005347Switchgrass RhizosphereVLDGSTIAPTDQIVIGVNQAQRVNSEAWWRGDIQAAAEAAVKHTK*
Ga0070671_10107707023300005355Switchgrass RhizosphereDPRETKYSTLVLDGSAVEPTDVIVVGINQAQRVGSDAWWRADLQPAAEAAVPLHKR*
Ga0070701_1030483623300005438Corn, Switchgrass And Miscanthus RhizosphereHLLEAKTTKFSTIVLDGSTIAPTDQIVIGVNQAQRVNSEAWWRGDIQAAAEAAVKHTK*
Ga0070681_1084949823300005458Corn RhizosphereETKYSTLVLDGSAIDATDVIVIGINQAQRGTSDPWWRADLQPAAEAAVPLRKR*
Ga0070707_10187952613300005468Corn, Switchgrass And Miscanthus RhizosphereTLEPHETKYSTLVLDGSAIDPTDVIVIGINQAQQVGSDAWWRADLQPAAEAAVPLKKR*
Ga0070698_10163236223300005471Corn, Switchgrass And Miscanthus RhizosphereDGGPVDPTDSIVIGVNQAQRRVSDPWWRADLQPAAEAAVPAKKP*
Ga0070699_10177004013300005518Corn, Switchgrass And Miscanthus RhizosphereHGTKYSTMVPDGFPIELTDTIVIGVNQAQRVGSEEWWQADLQAAAEDAAKRRKP*
Ga0070739_1051278213300005532Surface SoilLQNAETKYSTLVLDGSAIEPTDQIVVGVNAAQRVGSDAWWRGNPQALAEAAVNKKP*
Ga0070704_10162304913300005549Corn, Switchgrass And Miscanthus RhizosphereLDGGKVDPSGFIVIGVNQAQRVNPDTWWRADLRAAAEAAVPRQKQ*
Ga0066695_1001603633300005553SoilLDARSTKYSTLVLDGSPIDATDVIVVGVNQAQRVDSEAWWRADLQTMAEAAQRTKP*
Ga0070664_10161173113300005564Corn RhizosphereVLDGSTIEPTDIIVIGINQAQRVGSETWWRTDLQPAAEAAVPLKKR*
Ga0068854_10001976363300005578Corn RhizosphereTLVLDGSAIDATDVIVIGINQAQRVGSDAWWRADLQRAAEAAVPQRKP*
Ga0066706_1108489213300005598SoilTKYSTLVLDGSPIEPNFVIVIGANQAQRAGSEVWWRADLQPAAEAAVPLKKR*
Ga0066905_10048786433300005713Tropical Forest SoilTLVLDGTAVEPSDIVVIGVNQAQHVGSSEWWRAELRAAAEAAVPLKKQN*
Ga0068861_10224449023300005719Switchgrass RhizosphereKATQLAPGRRTLDARGTKYSTMVLDGSPIEPTDVIVVGVDQAQRAATEVWWRTDLRPAATAAAAAAQGKKP*
Ga0068861_10235249223300005719Switchgrass RhizosphereDPRETKYSAMVLDGSPVEPGDVIVAGINQAQRANSEAWWRADLQAAAEAKVPRKP*
Ga0068862_10163900623300005844Switchgrass RhizosphereTKYSTIVLDGGPVDPTDSVVVGVNQAQRRTTDPWWRADLQPAAEKAVPVKKP*
Ga0066652_10107860523300006046SoilLVLDGAPLDRADIVVVGINQVQRAGSEAWWRAELQRAAEAAVPLKKK*
Ga0079222_1223595413300006755Agricultural SoilYSSMVLDGSEIGPTDVIVAGVNQAQRAGSESWWRADVQRAAEAAVPRKKF*
Ga0066665_1037161213300006796SoilVAPGRRTLDARGTKYSAMVLDGFPIEPTDTVIVGVNQAQRVGSDAWWRAELQEAAQAAAAAKRPKEERRR*
Ga0075433_1112514113300006852Populus RhizosphereKYSTLVVDGGPVDPTDVIVIGINQAQHAGSDAWWRTDLQRAAEAAVPLKKP*
Ga0075434_10039699813300006871Populus RhizospherePARRTLDARSTKYSTVVLDGEPITAASTIVVGANQSQRVNSQTWWRADLQPAAEAAVKQKKP*
Ga0075424_10059509513300006904Populus RhizosphereYSTLVLDGSAVEPTDVIVVGINQAQRVGSDAWWRADLQPAAEAAVPLHKR*
Ga0079216_1049207213300006918Agricultural SoilIVLDGGPVDPAGSIVIGVNQVQRVNSDTWWKADLRAAAEAAVPRVKP*
Ga0105095_1055465813300009053Freshwater SedimentTKYSTIVLDGGPVDPADSIVIGINQVQRVNSDTWWRADLKAAAETAVPRKKP*
Ga0105240_1054927213300009093Corn RhizosphereVAPGRRSLDAHGAKYSSMVLDGSEIGPTDVIVAGVNQAQRAGSESWWRADVQRAAEAAVPRKKF*
Ga0075418_1003256653300009100Populus RhizosphereDGSPIGATDQIVIGVNQAQRANSETWWRTELQSTAEAAVKRKNP*
Ga0075418_1276142413300009100Populus RhizosphereAKTTKYSTIVLDGGKVDPAGFIVIGVNQAQRLSPDTWWRADLRATAEAAVPRKKP*
Ga0114129_1265910013300009147Populus RhizosphereGSPIDPTDLIVVGVNQAQKVNSEAWWRADLQPLAQAAVKQK*
Ga0105243_1102043213300009148Miscanthus RhizosphereDGSPIEAGDSIVIGVNQAQRVKSDVWWRADLQAAAEAVVRAKKR*
Ga0105249_1349388723300009553Switchgrass RhizosphereRETKYSAMVLDGSPAEAGDSIVVGVNQAQRVNSESWWRADLQAAAEARVPKKP*
Ga0105340_148097423300009610SoilYSTMVLDGSPVAPTDLVVVGVNQAQRVNSDVWWRAELQAAAEAAVKNSKP*
Ga0126380_1091742813300010043Tropical Forest SoilAHETKYSTLVLDGSDVEASDVIVIGINQVQHAGSDAWWRADLQRAAEALVPLKKP*
Ga0134127_1302374313300010399Terrestrial SoilARQVAPGRRTLEAHETKYSAMVLDGSPIEPGDSIVVGVNQVQRVNSDAWWRADLQAAAEARVPKKP*
Ga0134123_1112651533300010403Terrestrial SoilEAHEVKYSTLVLDGSKVDRTDIVVLGINQVQRAGSASWWRAELRRAAEAAVPLKKK*
Ga0137393_1066710423300011271Vadose Zone SoilARSTKYSTLVLDGSPVDPTDVIVVGVNQAQRVGSEVWWRAELQTAAEAATRGKKP*
Ga0137388_1062356533300012189Vadose Zone SoilVLDGSNVEPSDVIVIGINQTQHVGSNEWWRADLQPAAEATVPLKKP*
Ga0137387_1087417123300012349Vadose Zone SoilVAPGRRTLDAHGTKYSTLVLDGSPIEPTYAVVIGVNQAQRAGSEVWWHTDLQPAAEAAVPLKKR*
Ga0137375_1055695933300012360Vadose Zone SoilPHETKYSTLVLEGSEIDSTDVIVIGVHQAQQVGSDAWWRADLQRAAEAAVPLKKR*
Ga0150984_12366070723300012469Avena Fatua RhizosphereTLDPKETKYSTLVLDGSPVEPTDVIVVGINQVQRVGSEAWWRADLQPAAEAAVPLKK*
Ga0164299_1119255223300012958SoilAPGRRMLDPSGSKYSTLVLDGAEVDAADIVVVGVNQVQRVNSDAWWRADVQAAAEGLVPRKKP*
Ga0164308_1043866523300012985SoilVAPGRRSLDARETKYSAMVLDGSPIETGDVVVAGINQAQRVNSDAWWRADLQAAAEARVPRKP*
Ga0164307_1108486423300012987SoilAMVLDGSPVEPGDVIVAGINQAQRANSEAWWRADLQAAAEAKVPRKP*
Ga0157378_1279862213300013297Miscanthus RhizosphereRRTLDARGSKYSALVLDGSPIDPTDAIVVGVNQAQRVNSETWWRADLQVAAETAVPRKKK
Ga0157372_1288154713300013307Corn RhizosphereTKYSTLVLDGSAIDATDVIVIGINQAQRGTSDPWWRADLQPAAEAAVPLRKR*
Ga0157375_1349505223300013308Miscanthus RhizospherePGRRSLDPRETKYSAMVLDGSPVEPGDVIVAGINQAQRANSEAWWRADLQAAAEAKVPRKP*
Ga0157380_1233783323300014326Switchgrass RhizosphereLLEAKTTKFSTIVLDGSTIAPTDQIVIGVNQAQRVNSEAWWRGDIQAAAEAAVKHTK*
Ga0180086_102614813300014883SoilRTLDPRGTKHSTIVLDGSPIEPTDLIVVGVNQAQRVNSDVWWRAELQTAAEAAAQPRKP*
Ga0132258_1042962253300015371Arabidopsis RhizosphereRTLEAHEVKYSTLVLDGSKVDRTDIVVVGINQVQRAGSDAWWRAELQRAAEAAVPLKKK*
Ga0182041_1225046913300016294SoilVLDGSPIDPTDAIVIGVNQAQRVNSEVWWRADLQPAAEAAVPLKKR
Ga0187779_1095695723300017959Tropical PeatlandKYSTLVLDGSAIDATDQVVVGVNQAQRVNSEAWWRSDIQPAAEAAVKKKK
Ga0184634_1034923523300018031Groundwater SedimentRTLDPRGTKHSTIVLDGSPIEPTDLIVVGVNQAQRVNSEVWWRAELQGAAEAAAQPRKP
Ga0184632_1048748713300018075Groundwater SedimentTKYSTLVLDGGPIDPTDVIVVGINQVQRAGSDDWWRTELQPAAEAAVPVRKD
Ga0184639_1053543323300018082Groundwater SedimentEARSTKYSTIVLDGGPVDPADSSVIGVNQAQRRESDPWWRADLQPAAEAALPLKKP
Ga0184628_1029146913300018083Groundwater SedimentTLKARQVAPGRRSLDARETKYSAMVLDGSPVEPGDVIVAGVNQAQRVNSEAWWRADLQAAAEAKVPRKP
Ga0190265_1225745333300018422SoilTKYSTIVLDGGPVDPAGSIVIGVNQAQRVNSDTWWRADLRAAAEAAVPRVKQ
Ga0210382_1050569623300021080Groundwater SedimentTLVLDGSPIDATDVIVVGVNQSQRVGSEVWWRADLQTLAEAAAQRKKP
Ga0224510_1054628913300022309SedimentSTKYSTIVLDGSPVDPAGFIVIGVNQAQRVNSEIWWRADLKAAAETAVPRTKP
Ga0222623_1038264823300022694Groundwater SedimentVLDGGPVDPTDSIVIGVNQAQRKVSDPWWRADLQPAAEAAVPPKKP
Ga0209320_1017620423300025155SoilMVIDGAPVAATDVIVIGVNQAQRLDSDAWWRADLQPAAEATQRKQP
Ga0209343_1040034033300025311GroundwaterISAAPGRRTLNPRETKYSTMVIDGAPVAATDVIVIGVNQAQRLDSEAWWRADLQPAAEATQRKQP
Ga0209342_1120424713300025326SoilMVIDGAPVAATDVIVSGVNQAQRLDSDAWWRADLQPAAEATQRKQP
Ga0209751_1005038913300025327SoilMVIDGAPVAATDVIVIGVNQAQRLDSDAWWRADLQPA
Ga0209751_1102004513300025327SoilPRENKYSTMVIDGAPVAATDVIVIGVNQAQRLDSDAWWRADLQPAAEATQRKQP
Ga0207643_1026626513300025908Miscanthus RhizosphereRQVAPGRRALDARETKYSAMVLDGSPVEAGDAIVIGVNQAQRVGSDAWWRADVQAAAEARVPKKP
Ga0207705_1029454113300025909Corn RhizosphereVLDGSAIDATDVIVIGINQAQRGTSDPWWRADLQPAAEAAVPLRKR
Ga0207695_1118066023300025913Corn RhizosphereVLDGSEIGPTDVIVAGVNQAQRAGSESWWRADVQRAAEAAVPRKKF
Ga0207664_1001493783300025929Agricultural SoilLDAHGAKYSSMVLDGSEIGPTDVIVAGVNQAQRAGSESWWRADVQRAAEAAVPRKKF
Ga0207709_1127342023300025935Miscanthus RhizosphereGTLKARQVAPGRRTLDAHETKYSAMVLDGSPVEQGDSIVIGVNQAQRVSSDAWWRADLQAAAEARGPKKP
Ga0207691_1070211423300025940Miscanthus RhizosphereTLKARQVAPGRRSLDPHETKYSAMVLDGSPVEPGDVIVAGINQAQRANSEAWWRADLQAAAEAKVPRKP
Ga0207667_1023836313300025949Corn RhizosphereYSTLVLDGSAVEPTDVIVVGINQAQRVGSDAWWRADLQPAAEAAVPLHKR
Ga0207677_1112548123300026023Miscanthus RhizosphereTKYSTLVLDGAPIDATDVVVVGVNQAQRADSEVWWRADLQTMAEAKQPKKP
Ga0209131_127683813300026320Grasslands SoilEAHSTKFSAMVIDGSPIGPTDQIVIGVNQAQRVNSDAWWRGDIQPAAEAAARKKNR
Ga0209810_138879213300027773Surface SoilLQNAETKYSTLVLDGSAIEPTDQIVVGVNAAQRVGSDAWWRGNPQALAEAAVNKKP
Ga0207428_1114243413300027907Populus RhizosphereLEPNETKYSTLVVDGGQVDPTDVIVIGINQAQHTGSDAWWRTDLQRAAEAAVPLKKP
Ga0209006_1075558433300027908Forest SoilMVLDGSPIDTTDVIVLGVNQAQRVGSEVWWRADLQPAAEAATQRKKP
Ga0247663_110084313300028145SoilLDGSPIDPTDAIVVGVNQAQRVNSETWWRADLQVAAETAVPRKKK
Ga0307503_1067848523300028802SoilRRSLDARETKYSAMVLDGSPIEAGDVIVAGVNQAQRANSEAWWRADIQAAAEARVPRKP
Ga0307281_1030010223300028803SoilGRRSLDARETKYSAMVLDGSPVEPGDVIVAGINQAQRVNSEAWWRADLQAAAEAKVPRKP
Ga0308187_1040603323300031114SoilRRTLDPRETKYSTLVLDGSPIGPDFVIVIGANQAQRAGSEVWWHADLQPAAEAAVPLKKR
Ga0307500_1009061013300031198SoilTKYSAMVLDGSSIEAGDVIVAGVNQAQRANSEAWWRADIQAAAEARVPRKP
Ga0318555_1033266723300031640SoilGTKYSTLVLDGSPIEPTDQIVVGVNQAQRVNSDAWWRADIQAAAEGAARKKK
Ga0318536_1004712943300031893SoilKYSTLVLDGSPIEPTDQIVVGVNQAQRVNSDAWWRADIQAAAEGAARKKK
Ga0310901_1058516123300031940SoilVKYSTLVLDGSKVDRTDIVVLGINQVQRAGSDSWWRAELQRAAEAAVPLKKK
Ga0310885_1068282123300031943SoilTTKFSTIVLDGSPIAPTDQIVIGVNQAQRVNSEAWWRGDIQAAAEAIVKKK
Ga0306920_10300288323300032261SoilAPGRRTLDARGTKYSTLVLDGSPIEATDQIVVGVNQAQRVNSDAWWRADIQAAAEGAARKKK
Ga0310810_1131043723300033412SoilLEPNETKYSTLVVDGGPVDPTDVIVIGINQAQHAGSDAWWRTDLQRAAEAAVPLKKP
Ga0364933_071143_665_8683300034150SedimentKARQVAPGRRSLDARETKYSAMVLDGSPVEPGDVIVAGVNQAQRVNSEAWWRADIQAAAEARVPRKP
Ga0364940_0126063_2_1603300034164SedimentTKYSTIILDGGPVDPADSIVIGVNQAQRVNSDAWWRADLQPAAEAAVPRKKP
Ga0370499_0222991_329_5113300034194Untreated Peat SoilRRTLEARSTKYSTIVLDGGPVDPAGSIVIGVNQVQRVNSDTWWRADLQALAEAAVPRTKP
Ga0364923_0056905_768_9113300034690SedimentMVLDGSPLEPTDVVVVGVDQAQRAGSEAWWRADLQPAAIAAAKPKKP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.