NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100475

Metagenome / Metatranscriptome Family F100475

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100475
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 181 residues
Representative Sequence VDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQ
Number of Associated Samples 89
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 24.74 %
% of genes near scaffold ends (potentially truncated) 53.92 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.137 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(18.628 % of family members)
Environment Ontology (ENVO) Unclassified
(66.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(74.510 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 66.09%    β-sheet: 0.00%    Coil/Unstructured: 33.91%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01757Acyl_transf_3 1.96



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.12 %
UnclassifiedrootN/A5.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_100302251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1621Open in IMG/M
3300002835|B570J40625_100722115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum888Open in IMG/M
3300003802|Ga0007840_1002170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1218Open in IMG/M
3300004112|Ga0065166_10055623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1328Open in IMG/M
3300004686|Ga0065173_1071857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300004690|Ga0065175_1004024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum997Open in IMG/M
3300004772|Ga0007791_10039289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1587Open in IMG/M
3300004777|Ga0007827_10017042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1796Open in IMG/M
3300004784|Ga0007744_1280498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300004789|Ga0007752_10012321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300004789|Ga0007752_10993594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300004789|Ga0007752_11009037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1655Open in IMG/M
3300004790|Ga0007758_11166071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum892Open in IMG/M
3300004792|Ga0007761_11200643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1751Open in IMG/M
3300004792|Ga0007761_11354112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1402Open in IMG/M
3300004794|Ga0007751_11486705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1484Open in IMG/M
3300004795|Ga0007756_11364151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300004836|Ga0007759_10077821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1229Open in IMG/M
3300004836|Ga0007759_11505365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300004836|Ga0007759_11566661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum900Open in IMG/M
3300005662|Ga0078894_10266461All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300006112|Ga0007857_1059538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Conoidasida → Coccidia → Eucoccidiorida → Eimeriorina → Cryptosporidiidae → Cryptosporidium → Cryptosporidium muris722Open in IMG/M
3300007177|Ga0102978_1309020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1774Open in IMG/M
3300007202|Ga0103274_1119342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1855Open in IMG/M
3300008108|Ga0114341_10097986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1788Open in IMG/M
3300008110|Ga0114343_1077843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1199Open in IMG/M
3300008835|Ga0103883_1043137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300008957|Ga0104239_1026182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300008966|Ga0114357_1106413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1305Open in IMG/M
3300009155|Ga0114968_10090507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1885Open in IMG/M
3300009182|Ga0114959_10242690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum917Open in IMG/M
3300009466|Ga0126448_1015566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1857Open in IMG/M
3300010334|Ga0136644_10344381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum855Open in IMG/M
3300010354|Ga0129333_10211259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1762Open in IMG/M
3300010885|Ga0133913_11624536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1629Open in IMG/M
3300010885|Ga0133913_11883558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1492Open in IMG/M
3300010885|Ga0133913_13566037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1012Open in IMG/M
3300012471|Ga0129334_1021455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum965Open in IMG/M
3300012701|Ga0157562_1126549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300012708|Ga0157595_1119797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300012711|Ga0157607_1170553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300012717|Ga0157609_1256082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300012718|Ga0157557_1074259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1047Open in IMG/M
3300012720|Ga0157613_1242052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300012722|Ga0157630_1150836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300012730|Ga0157602_1079868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1483Open in IMG/M
3300012733|Ga0157606_1071533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300012733|Ga0157606_1317522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1578Open in IMG/M
3300012757|Ga0157628_1177025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum782Open in IMG/M
3300012765|Ga0138274_1234536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300012771|Ga0138270_1024781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300012965|Ga0129346_1059457Not Available518Open in IMG/M
3300013004|Ga0164293_10302900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1107Open in IMG/M
3300013094|Ga0164297_10199597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum778Open in IMG/M
3300013295|Ga0170791_13606532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300013295|Ga0170791_15883869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1191Open in IMG/M
3300013310|Ga0157622_1235378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300016693|Ga0180038_1074208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1096Open in IMG/M
3300017788|Ga0169931_10180984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1832Open in IMG/M
3300018649|Ga0192969_1027495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum907Open in IMG/M
3300018692|Ga0192944_1005975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1400Open in IMG/M
3300018730|Ga0192967_1034757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum839Open in IMG/M
3300018846|Ga0193253_1061993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300019036|Ga0192945_10004291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2230Open in IMG/M
3300019051|Ga0192826_10164442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum819Open in IMG/M
3300019117|Ga0193054_1059046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300020074|Ga0194113_11130432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300020083|Ga0194111_10280957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1157Open in IMG/M
3300020084|Ga0194110_10593543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300020159|Ga0211734_11178024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300020172|Ga0211729_10803865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300020179|Ga0194134_10149458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1063Open in IMG/M
3300020190|Ga0194118_10264757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum937Open in IMG/M
3300020197|Ga0194128_10133603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1450Open in IMG/M
3300020197|Ga0194128_10577738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300020205|Ga0211731_11109085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1924Open in IMG/M
3300020220|Ga0194119_10363139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum949Open in IMG/M
3300020221|Ga0194127_10139110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1756Open in IMG/M
3300020578|Ga0194129_10156073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1454Open in IMG/M
3300020732|Ga0214201_1036934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300020733|Ga0214172_1045851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300021093|Ga0194123_10162224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1189Open in IMG/M
3300021376|Ga0194130_10142595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1488Open in IMG/M
3300022752|Ga0214917_10358106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300025340|Ga0208866_1001119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1694Open in IMG/M
3300025357|Ga0208383_1005946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1633Open in IMG/M
3300025369|Ga0208382_1017477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1004Open in IMG/M
3300027899|Ga0209668_10075389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1897Open in IMG/M
3300027899|Ga0209668_10086144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1794Open in IMG/M
3300027963|Ga0209400_1257044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300028109|Ga0247582_1079052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300028282|Ga0256413_1043721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1539Open in IMG/M
3300030756|Ga0073968_11865041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300031062|Ga0073989_11302671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum958Open in IMG/M
3300032050|Ga0315906_10837242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300034066|Ga0335019_0233587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1176Open in IMG/M
3300034107|Ga0335037_0336362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum820Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake13.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake13.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater8.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.82%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.90%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.94%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.94%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.94%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.96%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.96%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.98%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.98%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.98%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004686Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2)EnvironmentalOpen in IMG/M
3300004690Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Jul07 (version 2)EnvironmentalOpen in IMG/M
3300004772Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5MEnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004784Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007202Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008957Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2EnvironmentalOpen in IMG/M
3300008966Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-53-LTREnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012701Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES061 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012711Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012718Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012730Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012757Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012765Freshwater microbial communities from Lake Croche, Canada - C_131016_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016693Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES036 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300020733Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300025340Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10030225113300002835FreshwaterMIMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAA
B570J40625_10072211513300002835FreshwaterMICYDAVFFSQGVVDMCYWRKMLRARSAVGDTFFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNETIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVK
Ga0007840_100217013300003802FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYW
Ga0065166_1005562323300004112Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARSAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0065173_107185713300004686FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKG
Ga0065175_100402413300004690FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQLDEENAEKLSGLSENIKNNNK
Ga0007791_1003928913300004772FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQLDEENAEKLSGLSENIKNNNKME*
Ga0007827_1001704213300004777FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENAEKLSGLSENIKNNNKME*
Ga0007744_128049813300004784Freshwater LakeKRKEIGNTSLAPIFVGLAIFMYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMAMIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEIVKADLTPDGELTEE*
Ga0007752_1001232113300004789Freshwater LakeMGVDMCYWRKMLRARAAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG*
Ga0007752_1099359413300004789Freshwater LakeMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENAEKLSG
Ga0007752_1100903713300004789Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARSAVGDTFFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNETIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDGQLEEKSRAVE*
Ga0007758_1116607113300004790Freshwater LakeMIMYDAVFFSQGVVDMCYWRKMLRKRKEIGNTSMAPIAVGLGIFLYSLTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHPTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKAADLTPDGELTEE*
Ga0007761_1120064313300004792Freshwater LakeMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENAEKLSGISENIKNNNKME*
Ga0007761_1135411233300004792Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARAAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNAL
Ga0007751_1148670543300004794Freshwater LakeMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQ
Ga0007756_1136415113300004795Freshwater LakeNQNLYHIFLMIMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAA
Ga0007759_1007782113300004836Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARSAVGETPFAPVAVCLAILLYSITSPMNYSDMGHLFFYPLYTSYTMQCLYTTGTWLWVFTIVWLMAAIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0007759_1150536513300004836Freshwater LakeIPYESGYHYAIWIKFLGPLASICLNNYKTQTPNQNLYHIFLMIMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAA
Ga0007759_1156666113300004836Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARAAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYE
Ga0078894_1026646133300005662Freshwater LakeMIMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENLNADKISGLSENIKNNNKME*
Ga0007857_105953813300006112FreshwaterIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENAEKLSGLSENIKNNNKME*
Ga0102978_130902013300007177Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARAAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTECTMQCLYTTGTWLWVFTIVWIMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0103274_111934213300007202Freshwater LakeMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQ*
Ga0114341_1009798623300008108Freshwater, PlanktonMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENLNADKISGLSENIKNNNKME*
Ga0114343_107784313300008110Freshwater, PlanktonMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKA
Ga0103883_104313713300008835Surface Ocean WaterKELTDTVVAPLAVGLFILMYSICSHMNYSNFGHLFFYPLYSDYTLQCLYTTGTWLFVFATVWFMAEIGNDKFHDTTYKYVTGAALYAYLSHYFFILIISVMIIRPYHIAFIPALFIMLFGTFLLIFITYWPLNALMELIFPPKETKSMDLRPEGEEPLTPEQ*
Ga0104239_102618213300008957FreshwaterRLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQA
Ga0114357_110641333300008966Freshwater, PlanktonMYDAVFFSQGVVDMCYWRKMLRKRKEIGNTSMAPIAVGLGIFLYSLTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHPTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKAADLTP
Ga0114968_1009050713300009155Freshwater LakeMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQLDEENAEKLSGLSENIKNKNKME*
Ga0114959_1024269013300009182Freshwater LakeMYDAVFFSQGVVDMCYWRKMLRKRKEIGNTSMAPIAVGLGIFLYSLTSPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHPIVYKYMTGASLYAYLSHYFFIIIISVTLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKAADLTPDGELTEE*
Ga0126448_101556623300009466Meromictic PondMLKKRGELADTVMAPIAIVAFIFIYSLTCPMNYSDMGHLFFYPLYGKYALQCLYTTGTWLWLYTIIWIFAKIANDKFNDTVYNYVCGSALYAYVSHYFFILLISVMIVRPYKMGFIPALFLMLFGCNLMIFLTYVPLNFIYELVVPPKETKKLEFAPEKEEMTPEE*
Ga0136644_1034438113300010334Freshwater LakeMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITY*
Ga0129333_1021125923300010354Freshwater To Marine Saline GradientMICYDAVFFSQGVVDMCYYRKMLRKRKELGNTVLAPTSMCLGLLIYSITSPMNYGDMGHLFFYPLYTDYTMQCFYTTGTWLWVFTIVWIMAYIANDKFDDTIYKYVTGASLYAYLSHYFFIILISATIVRPYHLGFLPALFLMYFGSFVLIFLTYIPLNALLELIIPPKETKAADLTPDGEVAEKP*
Ga0133913_1162453633300010885Freshwater LakeMCYWRKMLRKRKEIGNTSLAPIFVGLAIFMYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMAMIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEIVKADLTPDGELTEE*
Ga0133913_1188355833300010885Freshwater LakeMYDAVFFSQGVVDMCYWRKMLRKRKEIGNTSMAPIAVGLGIFLYSLTSPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHPIVYKYMTGASLYAYLSHYFFIIIISVTLVRPYKIKFIPAFFLMFFGTFFLIF
Ga0133913_1356603723300010885Freshwater LakeMLRARSAVGETPFAPVAVCLAILLYSITSPMNYSDMGHLFFYPLYTSYTMQCLYTTGTWLWVFTIVWLMAAIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG*
Ga0129334_102145523300012471AqueousMICYDAVFFSQGVVDMCYYRKMLRKRKELGNTVLAPTSMCLGLLIYSITSPMNYGDMGHLFFYPLYTDYTMQCFYTTGTWLWVFTIVWIMAYIANDKFDDTIYKYVTGASLYAYLSHYFFIILISATIVRPYHLGFLPALFLMYFGSFVLIFL
Ga0157562_112654913300012701FreshwaterVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQ
Ga0157595_111979713300012708FreshwaterMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYLFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNAL
Ga0157607_117055313300012711FreshwaterRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENLNADKISGLS
Ga0157609_125608223300012717FreshwaterFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG*
Ga0157557_107425923300012718FreshwaterMICYDAVFFSQGVVDMCYWRKMLRARSAVGDTFFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNETIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDGQLEEKSRAIE*
Ga0157613_124205223300012720FreshwaterLRARSAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYLFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG*
Ga0157630_115083613300012722FreshwaterRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEE
Ga0157602_107986833300012730FreshwaterMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADL
Ga0157606_107153323300012733FreshwaterAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYTLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG*
Ga0157606_131752233300012733FreshwaterMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQ
Ga0157628_117702513300012757FreshwaterPLASICLNNYKTQTPNQNLYHIFLMIMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENLNADKISGLSENIKNNNKME*
Ga0138274_123453613300012765Freshwater LakeMIMYDAVFFSQGVVDMCYWRKMLRKRKEIGNTSMAPIAVGLGIFLYSLTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHPTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELV
Ga0138270_102478113300012771Freshwater LakeMCYWRKMLRQRNELGATAVTPFAVCLAILLYSITSPMNYSDMGHLFFYPLYGEYSMQCMYTSGTWLWVFTIVWIMAYIGNDKFNETVYKYVTGASLYAYLSHYFFILIISVGIVRPYHLGFLPALFLMLFGTFFLIFITYWPLNALLELCFPPKEMKALDLTPDGEIAEEKQAVENAEADMA*
Ga0129346_105945713300012965AqueousKMLRKRREIANTFWAPLFVGVIIFMYSVTSPTNYGGFGQLFFYPLYSEYWLRCLYTTGTWTGVFITVWYMAAIGNEKFDDFTYKYVTVSALYAYLSHYFFILIISVGIVRPYHIGFIPALLLMFFGTFILIFITYYPLNLFLEALFPPVETTKAKDQDIPDGE*
Ga0164293_1030290013300013004FreshwaterMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENAEKLSGLSENIKNNNKME*
Ga0164297_1019959713300013094FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELI
Ga0170791_1360653213300013295FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAA
Ga0170791_1588386923300013295FreshwaterMICYDAVFFSQGVVDMCYWRKMLRSRAAVGETAFAPVSVCLLILLYSITSPMNYSDMGHLFFYPLYTDYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0157622_123537813300013310FreshwaterMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELV
Ga0180038_107420823300016693FreshwaterMICYDAVFFSQGVVDMCYWRKMLRARSAVGDTFFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNETIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0169931_1018098423300017788FreshwaterMICYDAVFFSQGVVDMCYWRKMLRARAAVGETFFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0181590_1072542313300017967Salt MarshMADSTLAPLSIVFFLFVYALTSPMVYSGMGHLFFYPLYSTYGLQCLYTTGTWLWVYTIIWIMAHIANDKFNDTVYNYVCGASLYAYVSHYFFILILSVMVVRPYKMKFIPALFVMLFGTFFLIFITYWPLNFIYELIVPPKETKKLDVDLTPEEAKQKAMMEEIEEEVLAGKGKG
Ga0181606_1069924213300018048Salt MarshMCYFKQMLKKRGELADGVMAPVTIVAFILIYSLTCPMNYSNMGHLFFYPLYSDYTLQCLYTTGTWMWLYTIIWMMAMIANDKFNDTIYNYVCGSALYAYVSHYFFILVISVLVVRPYKMGFIPALFLMLFGCNLMIFLTYVPLNFLYELVVPPKETKKLELAEEIEEMTPE
Ga0192969_102749513300018649MarineMCYYRKMLKIRKECGDTVLAPIMVGAGLFLYALCSPMNYGGLGQLFFYPLYEDYTLQCLYTTGTWLFVFTIVWVMAIVSNDKFNPTFYKYFTGASLYAYLSHYFWIILLSVTIVRPYHFGFPEAFCIMFFGTFVLIFITYWPLNALFELIFPPKETKSLDLSPEGEAMDLTPEQEAAAAAAAKADALEKGG
Ga0192944_100597513300018692MarineMCYYRKMLKIRKECGDTVLAPIMVGAGLFLYALCSPMNYGGLGQLFFYPLYEDYTLQCLYTTGTWLFVFTIVWVMAIVSNDKFNPTFYKYFTGASLYAYLSHYFWIILLSVTIVRPYHLGFPEAFCIMFFGTFVLIFITYWPLNALYELIFPPKETKSLDLSPEGEAMDLTPEQEAAAAAAAKADALEKGG
Ga0192967_103475713300018730MarineMINYDAIFFSQGVIDMCYYRKMLKIRKECGDTVLAPIMVGAGLFLYALCSPMNYGGLGQLFFYPLYEDYTLQCLYTTGTWLFVFTIVWVMAIVSNDKFNPTFYKYFTGASLYAYLSHYFWIILLSVTIVRPYHFGFPEAFCIMFFGTFVLIFITYWPLNALFELIFPPKETKSLDLSPEGEAMDLTPEQEAAAAAAAKADALEKGG
Ga0193253_106199313300018846MarineMICYDAIFFSQGVLDMAYWRKMLRHRKECAATVMAPIAVGVFIFLYALCSPTNYGDFGHLFFYPLFAEYWLQCLYTTGTWVFVYTTVWLMAAFGNSQYDGVSYKYVTGAALYAYLSHYFFILIISVLLVRPYQIGFIPALFIMLFGTFFLIFITYWPLNALYELAYPPKETQPADSTPEEGDERSP
Ga0192945_1000429113300019036MarineMINYDAIFFSQGVIDMCYYRKMLKIRKECGDTVLAPIMVGAGLFLYALCSPMNYGGLGQLFFYPLYEDYTLQCLYTTGTWLFVFTIVWVMAIVSNDKFNPTFYKYFTGASLYAYLSHYFWIILLSVTIVRPYHLGFPEAFCIMFFGTFVLIFITYWPLNALYELIFPPKETKSLDLSPEGEAMDLTPEQEAAAAAAAKADALEKGG
Ga0192826_1016444213300019051MarineMLKSRGYVSETPMAPIAIVMAILLYSLTCPMNYSDMGHLFFYPLYSTYGLQCLYTTGTWLWVYLIIWLMAKIGNDKFNDKVYNYVSGSSLYAYLSHYFFILIISVMIIRPYKINFIPALFIMLFGTNLLIFITYVPLNFLYELISPPKKTKAMDLTPHGEEKKEEPMEEKAAMAQERIAA
Ga0193054_105904613300019117MarineDMCYWRKMLRKRKELSDSVVAPLAVGLFILMYSICSPMNYSNFGHLFFYPLYADYTLQCLYTTGTWLFVFATVWIMAEIGNDKFHDTIYKYVTGSAMYAYLSHYFFILIISVMIIRPYHITFIPALFIMLFGTFLLIFLTYWPLNALYGLIFPPKETKSMDLRPEGEEPLTPEQQEAAAAAKADAIEGKGEE
Ga0194113_1113043213300020074Freshwater LakeVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFMIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0194111_1028095723300020083Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARKAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFLIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0194110_1059354313300020084Freshwater LakeGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFMIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0211734_1117802413300020159FreshwaterYKTQTPNQNLYHIFLMIMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAVAAAKAAAIEKGEAQQ
Ga0211729_1080386513300020172FreshwaterMIMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENLNADKISGLSENIKNNN
Ga0194134_1014945823300020179Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARAAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0194118_1026475713300020190Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARAIVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFMIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0194128_1013360313300020197Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARKAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFLIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFL
Ga0194128_1057773813300020197Freshwater LakePVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFMIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0211731_1110908513300020205FreshwaterMYDAVFFSQGVVDMCYWRKMLRKRKEIGNTSMAPIAVGLGIFLYSLTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHPTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKAADLTPDGELTEE
Ga0194119_1036313913300020220Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARAIVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0194127_1013911023300020221Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARKAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0208090_103506613300020513FreshwaterILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNETIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDGQLEEKSRAVE
Ga0194129_1015607313300020578Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARKAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFLIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLI
Ga0214201_103693413300020732FreshwaterEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENAEKLSGLSENIKNNNKME
Ga0214172_104585113300020733FreshwaterVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKISSYSTSPLAP
Ga0194123_1016222413300021093Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARKAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFMIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDG
Ga0194130_1014259513300021376Freshwater LakeMICYDAVFFSQGVVDMCYWRKMLRARKAVGETSFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAHIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYE
Ga0214917_1035810613300022752FreshwaterIGNTSMAPIAVGLGIFLYSLTSPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHPIVYKYMTGASLYAYLSHYFFIIIISVTLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKAADLTPDGELTEE
Ga0208866_100111943300025340FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQLDEENAEKLSGLSENIKNNNKME
Ga0208383_100594613300025357FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENAEKLSGLSENIKNNNKME
Ga0208382_101747713300025369FreshwaterMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWP
Ga0209668_1007538933300027899Freshwater Lake SedimentMCYWRKMLRKRKEIGNTSLAPIFVGLAIFMYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMAMIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEIVKADLTPDGELTEE
Ga0209668_1008614423300027899Freshwater Lake SedimentMICYDAVFFSQGVVDMCYWRKMLRARKAVGDTSMAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTDYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNDTIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALFELCFPPKEVKAMDLTPDGEIKEDKQIEV
Ga0209400_125704413300027963Freshwater LakeEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFNDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELIVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQLDEENAEKLSGLSENIKNNNKME
Ga0247582_107905213300028109SeawaterKLLGPAASICMNFWKVQTKNQNLYHIFLMINYDAIFFSQGVVDMCYWRKMLKVRKELGDTVWAPAMVGLGLFLYAICSPMNYGGLGQLFFYPLYEDYPLQCLYTTGTWLFVFSIVWIMALIGNDKFNETVYKYFAGSSLYAYLSHYFWIILLSVMIVRPYKLTFEEAFCVMFFGTFVLIFITYWPLNWLYELVFPPKEVKAMDLAPEGEEQE
Ga0256413_104372113300028282SeawaterMICYDAIFFSQGVLDMAYWRKMLRHRKECAATVMAPIAVGVFIFLYALCSPTNYGDFGHLFFYPLFAEYWLQCLYTTGTWVFVYTTVWLMAAFGNSQYDGVSYKYVTGAALYAYLSHYFFILIISVLLVRPYQIGFIPALFIML
Ga0256413_126572113300028282SeawaterFLYAICSPMNYGGLGQLFFYPLYDDYTLQCLYTTGTWTFVFTIVWVMAIVGNERFNETFYKYFTGSALYAYLSHYFWIILLSVLIVRPYHLGFPEAFCIMFFGTFVLIYATYWPLNALYELAFPPKETKAMDLSPEGEGDKDLTPEQEAAAAAAAKADALEKGAQPDDMEENVDKMS
Ga0073968_1186504113300030756MarineMINYDAVFFSQGVVDMCYWRKMLRKRKELSDSIVAPLAVGLFILMYSICSPMNYSNFGHLFFYPLYSDYTLQCLYTTGTWIFVFATVWTMAEIGNDKFNDTIYKYVTGAALYAYLSHYFFILIISVMIIRPYHIGFIPALFIMLFGTFLLIFITYWPLNALYELIFPPKETKSLDLKPEGEELTPE
Ga0073980_1132136613300031032MarinePMNYGGLGQLFFYPLYDDYTLQCLYTTGTYAFVYTIVWIMAEISNDKKNDTFFKYFTGASLYAYLSHYFFIILLSVLIVRPYKLTFPEAFCVMFFGTLVLIIITYWPLNALYELAFPPKETKPMDLSPEGEEEDLTPEAEAAAAAAAKADAIEKGDAAQDLEDNIDDKMSGASLKMEENN
Ga0073989_1130267113300031062MarineMLKSRGYVSETPMAPIAIVMAILIYSLTCPMNYSDMGHLFFYPLYSTYGLQCLYTTGTWLWVYLIIWLMAKIGNDKFNDKVYNYVSGSSLYAYLSHYFFILIISVMIIRPYKINFIPALFIMLFGTNLLIFITYVPLNFLYELISPPKKTKAMDLTPHGEEKKEEPMEEKAAMAQERIAA
Ga0315906_1083724213300032050FreshwaterLTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENLNADKISGLSENIKNNNKME
Ga0335019_0233587_164_8503300034066FreshwaterMYDAIFFSQGVVDMCYWRKMLRKRKEIGNTSLAPICVGIAIFLYALTCPMNYSEMGHLFFYPLYGNYTLQCLYTTGTWLWVFTIVWIMALIGNDKFHDTVYKYMTGASLYAYLSHYFFIIIISVSLVRPYKIKFIPAFFLMFFGTFFLIFITYWPLNALYELVVPPKEMKKADLTPDGELTEEQQAAAAAAAKAAAIEKGEAQQDEENLNADKISGLSENIKNNNKME
Ga0335037_0336362_22_5943300034107FreshwaterMICYDAVFFSQGVVDMCYCRKMLRARSAVGDTFFAPVTVVLAILLYSITSPMNYSDMGHLFFYPLYTEYTMQCLYTTGTWLWVFTIVWLMAYIGNDKFNETIYKYVTGASLYAYLSHYFFILIISVMIVRPYHIGFIPALFLMLFGTFFLIFITYWPLNALYELCFPPKEVKAMDLTPDGQLEEKSRAVE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.