NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100465

Metagenome / Metatranscriptome Family F100465

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100465
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 191 residues
Representative Sequence ANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Number of Associated Samples 81
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.97 %
% of genes near scaffold ends (potentially truncated) 92.16 %
% of genes from short scaffolds (< 2000 bps) 97.06 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.020 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(40.196 % of family members)
Environment Ontology (ENVO) Unclassified
(78.431 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(69.608 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 21.98%    β-sheet: 27.47%    Coil/Unstructured: 50.55%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00440TetR_N 0.98
PF00388PI-PLC-X 0.98



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.02 %
UnclassifiedrootN/A0.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001203|BBAY85_10014579All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae2380Open in IMG/M
3300007240|Ga0075176_1698012All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata520Open in IMG/M
3300008116|Ga0114350_1171584All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae571Open in IMG/M
3300008929|Ga0103732_1010459All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1218Open in IMG/M
3300008929|Ga0103732_1024163All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae883Open in IMG/M
3300008931|Ga0103734_1017522All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1018Open in IMG/M
3300008932|Ga0103735_1036275All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae711Open in IMG/M
3300008934|Ga0103737_1027573All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae722Open in IMG/M
3300009432|Ga0115005_10974696All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata686Open in IMG/M
3300009441|Ga0115007_11143924All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae540Open in IMG/M
3300009543|Ga0115099_10422682All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata921Open in IMG/M
3300009550|Ga0115013_10034203All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae2751Open in IMG/M
3300009592|Ga0115101_1438986All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae521Open in IMG/M
3300009606|Ga0115102_10391553All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae723Open in IMG/M
3300012408|Ga0138265_1360840All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae770Open in IMG/M
3300012412|Ga0138266_1514357All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae791Open in IMG/M
3300012414|Ga0138264_1006227All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae661Open in IMG/M
3300012414|Ga0138264_1648951All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae824Open in IMG/M
3300012415|Ga0138263_1913995All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae994Open in IMG/M
3300012417|Ga0138262_1118517All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae845Open in IMG/M
3300012417|Ga0138262_1283452All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae749Open in IMG/M
3300012418|Ga0138261_1450104All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae694Open in IMG/M
3300012418|Ga0138261_1883843All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae711Open in IMG/M
3300012782|Ga0138268_1095128All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae799Open in IMG/M
3300012952|Ga0163180_11020757All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae664Open in IMG/M
3300018635|Ga0193376_1015257All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae669Open in IMG/M
3300018675|Ga0193384_1020360All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae710Open in IMG/M
3300018684|Ga0192983_1034178All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae702Open in IMG/M
3300018713|Ga0192887_1044279All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae595Open in IMG/M
3300018718|Ga0193385_1019256All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae801Open in IMG/M
3300018718|Ga0193385_1020125All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae785Open in IMG/M
3300018730|Ga0192967_1046850All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae724Open in IMG/M
3300018739|Ga0192974_1056209All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae663Open in IMG/M
3300018791|Ga0192950_1054799All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae594Open in IMG/M
3300018825|Ga0193048_1076680All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae505Open in IMG/M
3300018848|Ga0192970_1072977All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae632Open in IMG/M
3300018848|Ga0192970_1078626All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae604Open in IMG/M
3300018874|Ga0192977_1059098All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae779Open in IMG/M
3300018874|Ga0192977_1059237All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae778Open in IMG/M
3300018885|Ga0193311_10063844All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae533Open in IMG/M
3300018934|Ga0193552_10208217All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae552Open in IMG/M
3300018942|Ga0193426_10122743All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae583Open in IMG/M
3300018948|Ga0192985_1153802All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae786Open in IMG/M
3300018974|Ga0192873_10241151All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae785Open in IMG/M
3300018980|Ga0192961_10231513All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae547Open in IMG/M
3300018981|Ga0192968_10093759All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae804Open in IMG/M
3300018981|Ga0192968_10128697All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae664Open in IMG/M
3300018982|Ga0192947_10109475All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae918Open in IMG/M
3300018982|Ga0192947_10113505All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata901Open in IMG/M
3300018982|Ga0192947_10168825All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae728Open in IMG/M
3300018982|Ga0192947_10173976All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae715Open in IMG/M
3300019010|Ga0193044_10215548All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata604Open in IMG/M
3300019021|Ga0192982_10033588All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1405Open in IMG/M
3300019021|Ga0192982_10229554All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae664Open in IMG/M
3300019021|Ga0192982_10247492All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae639Open in IMG/M
3300019022|Ga0192951_10164748All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae792Open in IMG/M
3300019040|Ga0192857_10216920All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae623Open in IMG/M
3300019049|Ga0193082_10379402All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae760Open in IMG/M
3300019049|Ga0193082_10686774All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae578Open in IMG/M
3300019050|Ga0192966_10189691All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae735Open in IMG/M
3300019103|Ga0192946_1053721All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae595Open in IMG/M
3300019123|Ga0192980_1060066All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae718Open in IMG/M
3300019153|Ga0192975_10233208All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae636Open in IMG/M
3300020578|Ga0194129_10207673All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1185Open in IMG/M
3300021348|Ga0206695_1706303All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata566Open in IMG/M
3300021887|Ga0063105_1015540All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1642Open in IMG/M
3300021890|Ga0063090_1098810All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata653Open in IMG/M
3300021893|Ga0063142_1092624All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae514Open in IMG/M
3300021899|Ga0063144_1027866All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae609Open in IMG/M
3300021899|Ga0063144_1047741All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae681Open in IMG/M
3300021899|Ga0063144_1121692All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae521Open in IMG/M
3300021932|Ga0063872_1107223All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae506Open in IMG/M
3300021950|Ga0063101_1109937All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae691Open in IMG/M
3300027849|Ga0209712_10417929All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae755Open in IMG/M
3300027859|Ga0209503_10050523All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1896Open in IMG/M
3300030670|Ga0307401_10401507All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae623Open in IMG/M
3300030702|Ga0307399_10483097All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae606Open in IMG/M
3300030709|Ga0307400_10433872All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae833Open in IMG/M
3300030865|Ga0073972_11295409All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae515Open in IMG/M
3300030948|Ga0073977_1653667All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae881Open in IMG/M
3300031036|Ga0073978_1611852All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae749Open in IMG/M
3300031522|Ga0307388_10311600All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae998Open in IMG/M
3300031522|Ga0307388_10640175All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae708Open in IMG/M
3300031550|Ga0307392_1046799All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae561Open in IMG/M
3300031710|Ga0307386_10413465All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae695Open in IMG/M
3300031717|Ga0307396_10471331All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae603Open in IMG/M
3300031725|Ga0307381_10233239All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae650Open in IMG/M
3300031729|Ga0307391_10383255All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae777Open in IMG/M
3300031729|Ga0307391_10389419All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae771Open in IMG/M
3300031729|Ga0307391_10915868All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae506Open in IMG/M
3300031734|Ga0307397_10477677All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae581Open in IMG/M
3300031737|Ga0307387_10274642All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata994Open in IMG/M
3300031737|Ga0307387_10304010All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae950Open in IMG/M
3300031739|Ga0307383_10344343All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae726Open in IMG/M
3300031742|Ga0307395_10240603All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae775Open in IMG/M
3300031742|Ga0307395_10445688All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae564Open in IMG/M
3300031750|Ga0307389_10442093All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae827Open in IMG/M
3300031752|Ga0307404_10421549All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae559Open in IMG/M
3300032650|Ga0314673_10399773All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata706Open in IMG/M
3300032730|Ga0314699_10404160All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata616Open in IMG/M
3300033572|Ga0307390_10352517All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae890Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine40.20%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine37.25%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine9.80%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica4.90%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.96%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.96%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.98%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.98%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001203Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY85Host-AssociatedOpen in IMG/M
3300007240Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300018635Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207)EnvironmentalOpen in IMG/M
3300018675Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789575-ERR1719413)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018718Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789426-ERR1719437)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030865Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY85_1001457943300001203Macroalgal SurfaceLLHTFFQKNASEAWNLVSMDFIDLCPAIMSLLVGFNFSNIDVVLATVQYGNPNFYRPSMSVTSKVQSHVVRNKVLFLNVGRDFGSNFGTLTLAYKIMDKYYSIVIHFDGTSVIVLNEYNHLQAGSREIVIEKGEEEGSVNPGGGGTIMTWSREEEGDGIEFDFDSPF*
Ga0075176_169801213300007240Wastewater EffluentMVSLLVGMNFGDFEIMLATVQYGNPNFFRPSMSVTSKVQSHVVRNKVLFLNVGRDFGSNFGTLTLAYKVRDKYFSIVIHFDGSSVIVLNEYNHMQAGSKEIIMEAGVEEGSINPGGGGTIMTWCKGEEEGDEIEFDFDSPF*
Ga0114350_117158413300008116Freshwater, PlanktonLMVGMNFSDFEIMLATVQYGNPNFFRPSMSVTSKVQSHVVRNKVLFLNVGRDFGSNFGTLTLAYKVRDKYYSIVIHFDGSSVIVLNEYNHVQAGSKEISMEAGVEEGSINPGGGGTIMTWCKGEEEGDEIEFDFDSPF*
Ga0103732_101045913300008929Ice Edge, Mcmurdo Sound, AntarcticaALETIQSTLGDKLFQGSKVDELLATPLKDLTMKGTQACVILHSRIYDEFTVGGVEYTEDLVSKDFSCFNADSWLKDKWDKTNDSKQLLEWNLGEVKAQGKQGKLLNSQFVLTPSVGSAGDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0103732_102416313300008929Ice Edge, Mcmurdo Sound, AntarcticaMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0103734_101752223300008931Ice Edge, Mcmurdo Sound, AntarcticaMKGTQACVILHSRIYDEFTVGGVEYTEDLVSKDFSCFNADSWLKDKWDKTNDSKQLLEWNLGEVKAQGKQGKLLNSQFVLTPSVGSAGDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0103735_103627513300008932Ice Edge, Mcmurdo Sound, AntarcticaMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0103737_102757313300008934Ice Edge, Mcmurdo Sound, AntarcticaPRAFFAACKGRSPSRRVAKRTSAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0115005_1097469613300009432MarineRHGAPVLHEFFAQNPDDNWNVVSMDYVDLTPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNDGEIEFDFDSPF*
Ga0115007_1114392413300009441MarineVLGWSSLQPVYLANDLYRPPKRHGAPILHEFFAQNPDENWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHLQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKE
Ga0115099_1042268213300009543MarineYNDAYVSKEYKCFSAQSWLEDKLYDTNDSKKLLEQNLDEVKTHGKQGKLVNNQFVLHADVNNAGDIIKLLLGWASLQPVYLANNLYKPQKRHGAPVLHEFFAQNPNDNWNLVSVDFVDLTPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKFLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEDGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0115013_1003420323300009550MarineMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0115101_143898613300009592MarineGWSTLQPVYLAIHLYKPQKRHGAPILHEFFAQNPNENWNIVSMDYVDLTPAMISLLVGINFSPFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEEASILVEEAPL*
Ga0115102_1039155313300009606MarineLELNLEEVVANGKKGKLLNNQFVLTPSVGGAGDLLKLIFGISSLQPVYLANDLYKPRKRHGAPTLHEFFAQNPDNNWNIVSMDYVDLTPAMISLLVGINFSIFDIMLATVQYGNPNFYRPSMSVTSKVKSHVMRDRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHIQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138265_136084013300012408Polar MarineVYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138266_151435713300012412Polar MarineSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPSMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138264_100622713300012414Polar MarineDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138264_164895123300012414Polar MarineKAQGKQGKLLNSQFVLTPSVGSAGDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138263_191399513300012415Polar MarineLHSRIYDEFTVGGVEYTEDLVSKDFSCFNADSWLKDKWDKTNDSKQLLEWNLGEVKAQGKQGKLLNSQFVLTPSVGSAGDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138262_111851713300012417Polar MarineMKGTQACVILHSRIYDEFTVGGVEYTEDLVSKDFSCFNADSWLKDKWDKTNDSKQLLEWNLGEVKAQGKQGKLLNSQFVLTPSVGSAGDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGG
Ga0138262_128345213300012417Polar MarineSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138261_145010423300012418Polar MarineSLQPVYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0138261_188384313300012418Polar MarineKDKWDKTNDSKQLLEWNLGEVKAQGKQGKLLNSQFVLTPSVGSAGDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEI
Ga0138268_109512813300012782Polar MarineDVVKLLLGWSSLQPVYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF*
Ga0163180_1102075713300012952SeawaterFFQKNADENWNLVSLDYIDLCPAIVSLLVGFNFSPFEIILATVQYGNPNFYRPSMSVTSKVQSHVVRNTVLFLNVGRDFGSNFGTLTLAYKIKDKYYSIFIHFDGSSVIVLNEYNHLQAGSKEVVMGEGEEEGTVNPGGGGTIMTWSKSEEGDEIEFDFDSPF*
Ga0193376_101525713300018635MarineLQPVYLANDLYKPQKRHGAPILHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193384_102036013300018675MarineLTPGLRSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNYYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEVAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192983_103417813300018684MarineHGDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192887_104427913300018713MarineLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSIEEDNGGEVEFDFDSPF
Ga0193385_101925613300018718MarineDKWYNTNDPKQLLEWNLEEVKSQGKKGKLLNNQFVLTPGLRSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPILHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNYYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEVAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193385_102012513300018718MarineNDSKQLLEWNLEEVKSQGKKGKLLNNQFVLTPGLRSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNYYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEVAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192967_104685013300018730MarineAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192974_105620913300018739MarineAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192950_105479923300018791MarineLYKPQKRHGAPILHEFFAQNPNENWNIVSMDYVDLTPAMISLLVGINFSPFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193048_107668013300018825MarineLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGRFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEDGAEEGSINPGGGGTIMTWSKEEDNG
Ga0192970_107297713300018848MarineVDLTPAMISLLVGINFSCFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192970_107862613300018848MarineLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192977_105909813300018874MarineANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192977_105923713300018874MarineANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193311_1006384413300018885MarineQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193552_1020821723300018934MarineISLLVGINFSSFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNENNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPFY
Ga0193426_1012274313300018942MarineRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLTTVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192985_115380213300018948MarineNLGHIVKLLLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192873_1024115113300018974MarineLQPVYMANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFFSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGTEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192961_1023151313300018980MarineIDLCPAIVSLLVGYNYSNFEILLATVQYGNPNFYRPSMSVTSKVQSHVMRNKVLFLNVGRDFGSNFGTLTLAYKVKDKYYTIVIHFDGSSVIVLNEYNHLQAGCKEVVMEDDAEEGSINPGGGGTVMTWAKSEEGDEIEFDFDSPF
Ga0192968_1009375913300018981MarineLANDLYKPQKRHGAPVLHEFFAQNPNENWNLVSMDYVDLTPAMISLLVGINFSCFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192968_1012869713300018981MarineAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEDGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192947_1010947513300018982MarineHCFNGDSWLEDKWYNTNDSKQLMEWNLEEVKSQGKKGKLLNNQFVLTPGLGSAGDILKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192947_1011350513300018982MarineYNTNNSKQLLEWNLEEVKAQGKKGKLLNNQFVLTPGIGSPGDILKLVLGWSSLQPVYLANDLYRPQKRHGAPILHEFFAQNPNDNWNLVSLDYVDLTPAMISLLVGVNFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192947_1016882513300018982MarineQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEDGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192947_1017397613300018982MarineYLANDLYKPKKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193044_1021554813300019010MarinePVYLANDLYRPQKRHGAPILHEFFAQNPNDNWNLVSLDYVDLTPAMISLLVGVNFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192982_1003358813300019021MarineVLTPSVGSAGDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPILHDFFAQNPNENWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEEAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192982_1022955423300019021MarineWSSLQPVYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192982_1024749213300019021MarineLHEFFAQNPHDKWNLVSMDYVDLTPAMISLLVGINFSNFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRNKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192951_1016474813300019022MarineKQLMEWNLEEVKSQGKKGKLLNNQFVLTPGLGSAGDILKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192857_1021692013300019040MarineDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFFSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193082_1037940223300019049MarineKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFFSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0193082_1068677413300019049MarineSMDYVDLSPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192966_1018969113300019050MarineVYMANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQSGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192946_105372113300019103MarineHEFFAQNPNDNWNLVSLDYVDLTPAMISLLVGVNFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192980_106006613300019123MarineYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0192975_1023320813300019153MarineINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0194129_1020767313300020578Freshwater LakePKKHGTATIHAFFAQNAREAWNAISLDYIDLCPAMVSLMVGMNFSDLDIILATVQYGNPNFYRPSMSVTSKVRSHVVRNKVLFLNVGRDFGSNFGTLTLAYKVNGKYFTIVIHFDGSSVIVLNEYNHIQAGSKEVAMEDGVEEGSVNPGGGGTLMTWCKAEDSNEIEFDFDSPF
Ga0206695_170630313300021348SeawaterDNWNLVSVDFVDLTPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEDGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0063105_101554023300021887MarineVGNLGDVVKLLLGWSSLQPVYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0063090_109881013300021890MarineLNNQFVLTPGIGSVGDILKLALGWSSLQPVYLANDLYRPQKRHGAPVLHEFFAQNPNDNWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0063142_109262413300021893MarineANDLYRPQKRHSAPVLHEFFAQNPNENWNLVSMDYLDLTPAMISLLVGINFSSFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDN
Ga0063144_102786613300021899MarineQKRHGAPVLHEFFAQNPHDKWNLVSMDYVDLTPAMISLLVGINFSNFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRNKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0063144_104774113300021899MarineLYKPQKRHGAPVLHEYFAQNPNENWNVVSMDFVDLTPAMVSALVGINFSPFDIMLATVQYGNPNFYRPSMSVTSKVESHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0063144_112169213300021899MarineLVSMDYLDLTPAMISLLVGINFSSFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPFY
Ga0063872_110722313300021932MarineLQPVYMANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGRFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEDGAEEGSINPGGDGTIT
Ga0063101_110993713300021950MarineVYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0209712_1041792913300027849MarineAQNPDDNWNVVSMDYVDLTPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0209503_1005052323300027859MarineLTPGIGSVSDIVKLVLGWSSLQPVYLANDLYRPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307401_1040150713300030670MarineGVGNLGHIVKLLLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307399_1048309713300030702MarineVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307400_1043387213300030709MarineNLGDVVKLLLGWSSLQPVYLANDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0073972_1129540923300030865MarineVLYIDLCPAMVSLFVGMNFSDFEVVLATVQYGNPNFYRPSMSVTSKVQSHVARNKVLFLNVGRDFGSNFGSLTLAYKIKDKYYSLVIHFDGTSVIVLHEYNHAQAGGKEIIIEDDMDEGSVNPGGGGTIMTWCKAEEGDEIDFDFDSPF
Ga0073977_165366713300030948MarineWLEDKWYNTNDAKQLLEWNLDEVKSQGKQGKLLNNQFVLTPGIGSAGDIVKLVLGWSSVQPVYLANDLYKPQKRHGAPVLHEFFAQNPKDNWNIVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0073978_161185213300031036MarineGDAWLEDKWYNTTDSKYLLECNLEEVKAAGKCGKLLNNQFVLTPGIGSAGDILKLVLGWTSLQPVYLANDLYKPQKRHGAPILHEFFAQNPDNNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307388_1031160013300031522MarineEDLVSKEYHCFSADSWLEDKWYNTNDAKQLLEWNLDEVKSQGKQGKLLNNQFVLTPGIGSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307388_1064017523300031522MarineSPGDIVKLLLGWSSLQPVYMANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSIEEDNGGEVEFDFDSPF
Ga0307392_104679913300031550MarineWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307386_1041346513300031710MarineRASDILKLILGWSTLQPVYLAIHLYKPQKRHGAPILHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307396_1047133113300031717MarineFFAQNPNDNWNLVSLDYVDLTPAMISLLVGVNFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307381_1023323913300031725MarineLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307391_1038325513300031729MarineQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307391_1038941913300031729MarineLNNQFVLTPGIGSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307391_1091586813300031729MarineLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKESVIEDGAEEGGSNPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307397_1047767713300031734MarineWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307387_1027464213300031737MarineLETPLKDLTMNGTQACVILHPRIYEDFIVDKVEYDAKKVAKDYNCFDAGSWLEDKWYNTNNSKQLLEWNLEEVKAQGKKGKLLNNQFVLTPGIGSPGDILKLVLGWSSLQPVYLANDLYRPQKRHGAPILHEFFAQNPNDNWNLVSLDYVVLTPAMISLLVGVNFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307387_1030401013300031737MarineAFNTEDLVSKEYHCFSADSWLEDKWYNTNDAKQLLEWNLDEVKSQGKQGKLLNNQFVLTPGIGSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307384_1036751013300031738MarineNFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307383_1034434313300031739MarineGSAGDIFKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPHEKWNLVSMDYVDLTPAMISLLVGINFSNFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRNKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307395_1024060313300031742MarineLGHIVKLLLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307395_1044568813300031742MarineNDLYKPQKRHGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSP
Ga0307389_1044209313300031750MarineADSWLEDKWYNTNDAKQLLEWNLDEVKSQGKQGKLLNNQFVLTPGIGSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0307404_1042154923300031752MarineGAPVLHDFFAQNPDDNWNLVSMDYVDLSPAMVSLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGRCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0314673_1039977313300032650SeawaterQFVLTPGIGSVGDILKLALGWSSLQPVYLANDLYRPQKRHGAPVLHEFFAQNPNDNWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF
Ga0314699_1040416013300032730SeawaterGKSGKLLNNQFVLTPGIGSVGDILKLALGWSSLQPVYLANDLYRPQKRHGAPVLHEFFAQNPNDNWNVVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKE
Ga0307390_1035251713300033572MarineVQYTEDLVSKEYHCFSADSWLEDKWYNTNDAKQLLEWNLDEVKSQGKQGKLLNNQFVLTPGIGSAGDIVKLVLGWSSLQPVYLANDLYKPQKRHGAPVLHEFFAQNPNDNWNLVSMDYVDLTPAMISLLVGINFSAFDIMLATVQYGNPNFYRPSMSVTSKVQSHVMRGKCLFLNVGKDFGSNFGTLTLAYRVLGKFYSIVIHFDGSSVIVLNEYNHMQAGSKEIVIEEGAEEGSINPGGGGTIMTWSKEEDNGGEIEFDFDSPF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.