NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100462

Metagenome / Metatranscriptome Family F100462

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100462
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 37 residues
Representative Sequence NGIKFAFPTVQVAGEGEAATAAVAQRALELTQPAAA
Number of Associated Samples 78
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 96.08 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.216 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.333 % of family members)
Environment Ontology (ENVO) Unclassified
(48.039 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.902 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 26.56%    β-sheet: 0.00%    Coil/Unstructured: 73.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01687Flavokinase 6.86
PF06574FAD_syn 6.86
PF13458Peripla_BP_6 6.86
PF08448PAS_4 4.90
PF00691OmpA 1.96
PF12833HTH_18 1.96
PF00239Resolvase 0.98
PF12806Acyl-CoA_dh_C 0.98
PF07642BBP2 0.98
PF12762DDE_Tnp_IS1595 0.98
PF09865DUF2092 0.98
PF07690MFS_1 0.98
PF09351DUF1993 0.98
PF10009DUF2252 0.98
PF00857Isochorismatase 0.98
PF00884Sulfatase 0.98
PF00083Sugar_tr 0.98
PF01968Hydantoinase_A 0.98
PF01425Amidase 0.98
PF14850Pro_dh-DNA_bdg 0.98
PF03992ABM 0.98
PF14559TPR_19 0.98
PF13701DDE_Tnp_1_4 0.98
PF06445GyrI-like 0.98
PF03060NMO 0.98
PF02470MlaD 0.98
PF12625Arabinose_bd 0.98
PF05598DUF772 0.98
PF06411HdeA 0.98
PF06186DUF992 0.98
PF01152Bac_globin 0.98
PF00106adh_short 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0196FAD synthaseCoenzyme transport and metabolism [H] 13.73
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.98
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.98
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.98
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.98
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.98
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.98
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.98
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.20 %
UnclassifiedrootN/A9.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01CEOVZAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300004080|Ga0062385_10990216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300004635|Ga0062388_101174930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300005367|Ga0070667_100159406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1986Open in IMG/M
3300005435|Ga0070714_100449668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1224Open in IMG/M
3300005764|Ga0066903_103995749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria791Open in IMG/M
3300005921|Ga0070766_11070779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria556Open in IMG/M
3300006028|Ga0070717_11493394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus613Open in IMG/M
3300007255|Ga0099791_10363716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium694Open in IMG/M
3300009012|Ga0066710_101659297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium975Open in IMG/M
3300009137|Ga0066709_103724954All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300010359|Ga0126376_10615519All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300010360|Ga0126372_12754248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300010361|Ga0126378_11312081All Organisms → cellular organisms → Bacteria → Proteobacteria818Open in IMG/M
3300010361|Ga0126378_11663980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria725Open in IMG/M
3300010361|Ga0126378_11974041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium665Open in IMG/M
3300010361|Ga0126378_13230133All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300010376|Ga0126381_101266373All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300010376|Ga0126381_101464885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria987Open in IMG/M
3300010376|Ga0126381_103885999Not Available583Open in IMG/M
3300010398|Ga0126383_13559438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300011120|Ga0150983_12968021All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300012208|Ga0137376_10771468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300012208|Ga0137376_11079294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium687Open in IMG/M
3300012957|Ga0164303_10794034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300016270|Ga0182036_10504851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria958Open in IMG/M
3300016357|Ga0182032_10257109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1360Open in IMG/M
3300016371|Ga0182034_10060428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2551Open in IMG/M
3300016404|Ga0182037_12058332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300017943|Ga0187819_10191346All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300018431|Ga0066655_11357783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300018468|Ga0066662_11502086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium701Open in IMG/M
3300020579|Ga0210407_10978560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales646Open in IMG/M
3300020582|Ga0210395_10222836All Organisms → cellular organisms → Bacteria → Proteobacteria1416Open in IMG/M
3300021168|Ga0210406_11262294All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300021406|Ga0210386_10542791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1005Open in IMG/M
3300021441|Ga0213871_10183219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300021475|Ga0210392_11081917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300021560|Ga0126371_11097453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria935Open in IMG/M
3300021560|Ga0126371_11188070All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300021560|Ga0126371_11438758All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300021560|Ga0126371_13745024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300021560|Ga0126371_13940322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300022724|Ga0242665_10094486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales877Open in IMG/M
3300025910|Ga0207684_11534746Not Available541Open in IMG/M
3300027783|Ga0209448_10068472All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter1194Open in IMG/M
3300031040|Ga0265754_1013881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium678Open in IMG/M
3300031231|Ga0170824_103779464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1067Open in IMG/M
3300031231|Ga0170824_103782841All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031474|Ga0170818_111178892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1023Open in IMG/M
3300031561|Ga0318528_10294162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria871Open in IMG/M
3300031572|Ga0318515_10719610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales528Open in IMG/M
3300031668|Ga0318542_10336260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300031681|Ga0318572_10289983Not Available966Open in IMG/M
3300031708|Ga0310686_111440181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria695Open in IMG/M
3300031708|Ga0310686_117423899Not Available625Open in IMG/M
3300031719|Ga0306917_10525936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria929Open in IMG/M
3300031724|Ga0318500_10366819Not Available713Open in IMG/M
3300031744|Ga0306918_10195407All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300031744|Ga0306918_10559275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium896Open in IMG/M
3300031751|Ga0318494_10422731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria774Open in IMG/M
3300031754|Ga0307475_10762944Not Available769Open in IMG/M
3300031771|Ga0318546_11248485Not Available522Open in IMG/M
3300031781|Ga0318547_10641493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6659Open in IMG/M
3300031792|Ga0318529_10004100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4920Open in IMG/M
3300031795|Ga0318557_10135102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1110Open in IMG/M
3300031805|Ga0318497_10328660All Organisms → cellular organisms → Bacteria → Proteobacteria853Open in IMG/M
3300031805|Ga0318497_10643441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300031824|Ga0307413_11825476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300031833|Ga0310917_10396166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria938Open in IMG/M
3300031879|Ga0306919_10345181All Organisms → cellular organisms → Bacteria → Proteobacteria1136Open in IMG/M
3300031879|Ga0306919_10396494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1058Open in IMG/M
3300031879|Ga0306919_10626766Not Available829Open in IMG/M
3300031890|Ga0306925_11200703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria760Open in IMG/M
3300031890|Ga0306925_11766274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300031910|Ga0306923_11362115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300031912|Ga0306921_10252567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2066Open in IMG/M
3300031912|Ga0306921_11041015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium921Open in IMG/M
3300031941|Ga0310912_10081086All Organisms → cellular organisms → Bacteria2356Open in IMG/M
3300031941|Ga0310912_10509268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium938Open in IMG/M
3300031954|Ga0306926_11528897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae769Open in IMG/M
3300031954|Ga0306926_12162997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300031959|Ga0318530_10093318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1190Open in IMG/M
3300031959|Ga0318530_10489999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300031962|Ga0307479_12105956All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300032001|Ga0306922_10650486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1113Open in IMG/M
3300032001|Ga0306922_12050479Not Available556Open in IMG/M
3300032025|Ga0318507_10475764All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300032035|Ga0310911_10128218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1414Open in IMG/M
3300032035|Ga0310911_10811800All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300032043|Ga0318556_10651141All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300032051|Ga0318532_10288866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300032060|Ga0318505_10458429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria602Open in IMG/M
3300032063|Ga0318504_10199852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium933Open in IMG/M
3300032068|Ga0318553_10072465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1727Open in IMG/M
3300032068|Ga0318553_10499767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria637Open in IMG/M
3300032076|Ga0306924_10809838All Organisms → cellular organisms → Bacteria → Proteobacteria1043Open in IMG/M
3300032094|Ga0318540_10355702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria707Open in IMG/M
3300032180|Ga0307471_101029132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium990Open in IMG/M
3300032261|Ga0306920_101496850Not Available964Open in IMG/M
3300033289|Ga0310914_10336283All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1364Open in IMG/M
3300033417|Ga0214471_10284943All Organisms → cellular organisms → Bacteria → Proteobacteria1346Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil14.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300031040Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_053379302189573000Grass SoilIKFAFPTVSVTGDGEASAATAAVAQRGLELTHPAAAAAE
Ga0062385_1099021623300004080Bog Forest SoilANGVKFAFPTVQIASDGEPSPAATAGAAKRALELTKPAAAAAE*
Ga0062388_10117493023300004635Bog Forest SoilFDENGIKFAVPTVQVAGEGDTATAAAAQRALKLTQTAAV*
Ga0070667_10015940623300005367Switchgrass RhizosphereANGIKFAIPTVQLSGDGDPSKPATAAAVAHQTLQLTQPAAAE*
Ga0070714_10044966813300005435Agricultural SoilANGIKFAFPTVQVAGEGEASTAAVAQRALELTRPAAAAAE*
Ga0066903_10399574913300005764Tropical Forest SoilENGIKFAFPTVQVAGEAEAANAAVAQHALELTRPAAA*
Ga0070766_1107077913300005921SoilANGIKFAFPTVQIAGDGEPSAAAVAHRALELTQPAAA*
Ga0070717_1149339423300006028Corn, Switchgrass And Miscanthus RhizosphereDANGIKFAYPTVQIAGDGEPSSAAVAHRALELTQPAAA*
Ga0099791_1036371613300007255Vadose Zone SoilNGIKFAFPTVSVTGEGEASAATGAVAQRALELTHPAAAAAD*
Ga0066710_10165929733300009012Grasslands SoilGIKFAFPTVSVAGEGEPATAALAQRGLELTRPSAAAAE
Ga0066709_10372495423300009137Grasslands SoilKFAFPTVSVTGEGEPATAAVAQRALELTHPAAAAE*
Ga0126376_1061551913300010359Tropical Forest SoilKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA*
Ga0126372_1275424823300010360Tropical Forest SoilEFAFPTVQVAGGGEPTVAAARQGLEMMKPPAAEA*
Ga0126378_1131208123300010361Tropical Forest SoilDENDIKFAFPTVQVAGEGAPATTAVAQRALELTRPAAAE*
Ga0126378_1166398013300010361Tropical Forest SoilGIKFAFPTVQVAGEGETPTAAVAQRALELTQPAAAAE*
Ga0126378_1197404113300010361Tropical Forest SoilFAFPTVQVAGDGEPSTAAVAQRGLELTRPQPEAAE*
Ga0126378_1323013323300010361Tropical Forest SoilNGIKFAFPTVQVAGDAEPATAAAARQALALAQPQPQAAE*
Ga0126381_10126637313300010376Tropical Forest SoilGIKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA*
Ga0126381_10146488513300010376Tropical Forest SoilNGIKFAFPTVQVAGEGEPATSAAAQHALELTRPVAAA*
Ga0126381_10388599913300010376Tropical Forest SoilFDENAIKFAFPTVQVAGDREPVEVAAAQKALTLTQPTAA*
Ga0126383_1355943813300010398Tropical Forest SoilSGIKFAFPTVQVAGEGEAATAAVAQRGLDLTRPQPAAAE*
Ga0150983_1296802113300011120Forest SoilGIKFAFPTVQIAGEGDAATAAIAERALELTRPQAAE*
Ga0137376_1077146813300012208Vadose Zone SoilIKFAFPTVSVTGEGEPATAAVAQRGLELTHPAAAAAE*
Ga0137376_1107929433300012208Vadose Zone SoilFAFPTVSVAGEGEPATAALAQRGLELTRPSAAAAE*
Ga0164303_1079403423300012957SoilENGIKFAFPTVSVTGEGEPATAAVAQRALELTHPAAAAAE*
Ga0182036_1050485113300016270SoilNGIKFAFPTVQVAGEGEAATAAVAQRGLELTQPAAA
Ga0182032_1025710913300016357SoilGIKFAFPTVQVAGESEVATAAVAQRGLELIRPQAATGE
Ga0182034_1006042833300016371SoilIKFAFPTVQVAGEGEASTAAVAQRALELTQPQAAA
Ga0182037_1205833223300016404SoilKFAFPTVQVAGEGEPTTAAVAQRGLELTHPAAAAAQ
Ga0187819_1019134623300017943Freshwater SedimentANGIKFAFPTVQLAGEGEPSAHATAAVAQQALALTRPHAAE
Ga0066655_1135778313300018431Grasslands SoilFAFPTVSVAGDGEPSTAAVAQRGLELTHPAAAAAE
Ga0066662_1150208623300018468Grasslands SoilENGIKFAFPTVQVAGESEAAGTTAAVAQRGLELTHPAAVAAE
Ga0210407_1097856023300020579SoilFAYPTVQIAGDGEPSTDATAAVAQRALELTKPAAA
Ga0210395_1022283633300020582SoilNGIKFAFPTVQVAGEGETSAATAAVAQRTLELAKPAAA
Ga0210406_1126229413300021168SoilGIKFAFPTVQIAGDGEPSTDATAAVAHRALELTKPTAA
Ga0210386_1054279113300021406SoilFAYPTVQIAGDGEPSRAAVAQRALELTRPAAAAAE
Ga0213871_1018321923300021441RhizosphereENGIKFAFPTVQIAGEGEAAAAAAARHALELTQPTAAE
Ga0210392_1108191723300021475SoilWIKFAFPTVQIAGEGEPATAAVAQRGLELTHPAAAAAE
Ga0126371_1109745323300021560Tropical Forest SoilENGIKFAFPTVQVAGEGEPATVAVAQRAPELTQPAAA
Ga0126371_1118807013300021560Tropical Forest SoilGIKFAFPTVQVAGEGEAATTAVAQRGLELTRPQPAAAAE
Ga0126371_1143875813300021560Tropical Forest SoilIKFAFPTVQVAGEGESATAAVAQRGPELTRSQPAAAE
Ga0126371_1374502413300021560Tropical Forest SoilENGIKFAFPTVQVAGGGEGATATAVARQALELSRQQAAE
Ga0126371_1394032213300021560Tropical Forest SoilENGIKFAFPTVQVAGEGAPATTAVAQRALELTRPAAAE
Ga0242665_1009448613300022724SoilRHQIRLPTVQVAGEGDTSAATAAVAQRTLELVKPAVV
Ga0207684_1153474623300025910Corn, Switchgrass And Miscanthus RhizosphereNGIKFAFPTVSVTGEGEPVTAATAAVAQRALELTHPAAAAADS
Ga0209448_1006847223300027783Bog Forest SoilENGIKFAFPTVSVTGEGETSAATAAIAQRTLELAKPAAAAA
Ga0265754_101388113300031040SoilGIKFAYPTVQLAGDGEPATAAIAQQALQLTHPTAAAAE
Ga0170824_10377946413300031231Forest SoilNGIKFAFPTVQVAGEGEPSRGAIAQEGLALTRPQAAE
Ga0170824_10378284113300031231Forest SoilNGIKFAFPTVQVAGEGEPSRGAIAQEGLALTRPQEAE
Ga0170818_11117889213300031474Forest SoilKFAFPTVQIAGDGEPSTAATAAVAQRALELTKPAAA
Ga0318528_1029416223300031561SoilKFAFPTVQVAGEGEPSTAAVAQRGLELTHPAAAAAAQ
Ga0318515_1071961013300031572SoilCNGIKFAFPTVQIAGDGEPSTAATAGAAQRALEMTQPAAA
Ga0318542_1033626013300031668SoilIKVAVPTVQVAGEGEASTAAVAQRALELTQPQAAA
Ga0318572_1028998313300031681SoilIKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA
Ga0310686_11144018113300031708SoilGIKFAFPTVQVAGEGDTPAATAAVAQRALELTRPAAAAAR
Ga0310686_11742389913300031708SoilFDENGIKFAFPTVQLAGDGDPSTAAIAQRTLELLHPATV
Ga0306917_1052593613300031719SoilKFAFPTVQVAGEGEPSTAAVAQRGLELTRPAAAAAE
Ga0318500_1036681923300031724SoilIKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA
Ga0306918_1019540713300031744SoilNGIKFAFPTVQVAGEGEPATAAAAQHALELSRPVAAA
Ga0306918_1055927523300031744SoilEHGIKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA
Ga0318494_1042273113300031751SoilGIKFAFPTVQVAGETEAATAAVAQHALGLTRPVAAG
Ga0307475_1076294413300031754Hardwood Forest SoilENGIKFAFPTVSVTGEGEPSNAAVAQRTLELVHPAPV
Ga0318546_1124848513300031771SoilHGIKFAFPTVQVAGQGEAATAAVAHRTLELTQPPAAA
Ga0318547_1064149323300031781SoilGIKVAFTTVQVAGESEPSTAAVAQRALELTQPAAA
Ga0318529_1000410053300031792SoilFAFPTVQVAGEGEPSTAAVAQRGLELTHPAAAAAAQ
Ga0318557_1013510233300031795SoilIKFAFPTVQLAGEGEPSPAATAAVAQQALQLTRPAAAAAE
Ga0318497_1032866013300031805SoilGIKFAFPTVQVAGEAEAATAAVAQHGLELTRPAAA
Ga0318497_1064344113300031805SoilGIKFAFPTVQVAGEGDTSAATAAVAQRALELTHPAAAAAE
Ga0307413_1182547623300031824RhizosphereNGIKFAFPTVQVAGGAEGPVAPAVAQQAIDMLEKPAAE
Ga0310917_1039616613300031833SoilIKFAFPTVQVAGEGEPSRAAIAREALELTRPAAAAAE
Ga0306919_1034518113300031879SoilIKFAFPTVQVAGEAEPATTTAAVPQRGLELTQPAAA
Ga0306919_1039649433300031879SoilGIKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA
Ga0306919_1062676613300031879SoilKAFDENDIKFAFPTVQVAGETEAATAAVAQHALGLTRPVAAG
Ga0306925_1120070323300031890SoilEHGIKFAFPTVQVAGDGEAATAAVAQRGLELTRPQPEAAE
Ga0306925_1176627423300031890SoilNGIKFAFPTVQIAGEGEAANAAAARRVLELTQPAAAE
Ga0306923_1136211513300031910SoilFAFPTVQVAGGEGEPSTAAVAQRGLELTHPQAAAAAE
Ga0306921_1025256743300031912SoilGIKFAFPTVQVAGEGEPATAAVAQRGLELTHPAAAAE
Ga0306921_1104101513300031912SoilFAYPTVQVAGAGEGESTTAAVSQQALELTRPQAAE
Ga0310912_1008108633300031941SoilDENGIKFAFPTVQVAGEGEPSRAAIAREALELTRPAAAAAE
Ga0310912_1050926833300031941SoilDANGIKFAFPTVQLAGEGEPSPAATAAVAQQALQLTRPAAAAAE
Ga0306926_1152889713300031954SoilIKFAFPTVQVAGEGEAATAAVAQRGLELTRPQPAAAE
Ga0306926_1216299713300031954SoilMSDLLVIAFPTVQVAGEGKAAVADLARRALELTQPAAAE
Ga0318530_1009331813300031959SoilPTVQLAGEGEPSPAATAAVAQQALQLTRPAAAAAE
Ga0318530_1048999913300031959SoilDENGIKFAFPTVQVAGEAEATTAAVAQRGLELTQPAAA
Ga0307479_1210595623300031962Hardwood Forest SoilIKFAFPTVQIAGEGDAATAAIAERALELTRPQAHAAE
Ga0306922_1065048623300032001SoilGIKFAFPTVQVAGDGEPSTAAVAQRGLELTHPAAAAAE
Ga0306922_1205047913300032001SoilGIKFAFPTVQVAGETEAATAAVAQRALELAHPAAAE
Ga0318507_1047576413300032025SoilGIKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA
Ga0310911_1012821833300032035SoilENSIKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA
Ga0310911_1081180023300032035SoilNGIKFAFPTVQVAGETEGAAAAAVAQRGLELTQPAAA
Ga0318556_1065114133300032043SoilIKFAFPTVQVAGEGDASAATAAVAQRTLELTHPAAA
Ga0318532_1028886623300032051SoilFSFPTVQVAGEGEPSTAAVAQRGLELTRPQPAAAE
Ga0318505_1045842913300032060SoilNGIKFAFPTVQVAGETEAATAAVAQHALGLTQPVAAE
Ga0318504_1019985223300032063SoilKFAFPTVQVAGGEGEPSTAAVAQRGLELTHPQAAAAAE
Ga0318553_1007246543300032068SoilFAFPTVQVAGEGEPSTAAVAQRGLELTRPAAAAAE
Ga0318553_1049976723300032068SoilIKFAFPTVQVAGEGEPSTAAVAQRGLELTHPAAAAAAQ
Ga0306924_1080983823300032076SoilIKFAFPTVQVAGEGEPATAAAAQHALELTRPVEAA
Ga0318540_1035570213300032094SoilFAFPTVQVAGEGEPSRAAIAREALELTRPAAAAAE
Ga0307471_10102913223300032180Hardwood Forest SoilGIKFAFPTVSVTGEGEPATAATAAVAQRGLELTHPVVAAAE
Ga0306920_10149685013300032261SoilENAIKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA
Ga0310914_1033628313300033289SoilNGIKFAFPTVQVAGEGEAATAAVAQRALELTQPAAA
Ga0214471_1028494343300033417SoilFDQNGIKFAFPTVQGAGSGDAAAVAAARQGLGLTLPPPAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.