Metagenome / Metatranscriptome Family F100268

Basic Information
Family ID	F100268
Family Type	Metagenome / Metatranscriptome
Number of Sequences	102
Average Sequence Length	44 residues
Representative Sequence	FPLGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNVFADD
Number of Associated Samples	66
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	4.90 %
% of genes near scaffold ends (potentially truncated)	64.71 %
% of genes from short scaffolds (< 2000 bps)	98.04 %
Associated GOLD sequencing projects	66
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Most Common Taxonomy
Group	Eukaryota (76.471 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (78.431 % of family members)
Environment Ontology (ENVO)	Unclassified (93.137 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (87.255 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF13456	RVT_3	0.98
PF00665	rve	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.98
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.98
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.98
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.98

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	77.45 %
Unclassified	root	N/A	22.55 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	77.45 %
Unclassified	root	N/A	22.55 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	76.47 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	76.47 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	76.47 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	74.51 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	74.51 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	74.51 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	74.51 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	74.51 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	74.51 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	73.53 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	73.53 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	73.53 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	73.53 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	73.53 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	73.53 %
Unclassified	root	N/A	22.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	68.63 %
Unclassified	root	N/A	22.55 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.96 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	68.63 %
Unclassified	root	N/A	22.55 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	1.96 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	68.63 %
Unclassified	root	N/A	22.55 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	1.96 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	68.63 %
Unclassified	root	N/A	22.55 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	1.96 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	68.63 %
Unclassified	root	N/A	22.55 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1.96 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	68.63 %
Unclassified	root	N/A	22.55 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.98 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.98 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	68.63 %
Unclassified	root	N/A	22.55 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.98 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.98 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	68.63 %
Unclassified	root	N/A	22.55 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.98 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.98 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005615\|Ga0070702_100674254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	785	Open in IMG/M
3300005617\|Ga0068859_102099140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	624	Open in IMG/M
3300009092\|Ga0105250_10135984	Not Available	1016	Open in IMG/M
3300009553\|Ga0105249_12037245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	647	Open in IMG/M
3300009975\|Ga0105129_112849	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	592	Open in IMG/M
3300009980\|Ga0105135_100475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1598	Open in IMG/M
3300009980\|Ga0105135_118297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	602	Open in IMG/M
3300009992\|Ga0105120_1056575	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	501	Open in IMG/M
3300009994\|Ga0105126_1034490	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	606	Open in IMG/M
3300009994\|Ga0105126_1055674	Not Available	507	Open in IMG/M
3300009995\|Ga0105139_1019547	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	999	Open in IMG/M
3300010371\|Ga0134125_10876460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	986	Open in IMG/M
3300010401\|Ga0134121_11382293	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	714	Open in IMG/M
3300010403\|Ga0134123_11200137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	789	Open in IMG/M
3300015270\|Ga0182183_1007968	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1026	Open in IMG/M
3300015270\|Ga0182183_1013722	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	892	Open in IMG/M
3300015270\|Ga0182183_1074481	Not Available	545	Open in IMG/M
3300015273\|Ga0182102_1003377	Not Available	978	Open in IMG/M
3300015273\|Ga0182102_1010879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	736	Open in IMG/M
3300015284\|Ga0182101_1049328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	641	Open in IMG/M
3300015290\|Ga0182105_1022801	Not Available	840	Open in IMG/M
3300015290\|Ga0182105_1068324	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	593	Open in IMG/M
3300015290\|Ga0182105_1097271	Not Available	524	Open in IMG/M
3300015293\|Ga0182103_1076052	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	560	Open in IMG/M
3300015301\|Ga0182184_1073109	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	564	Open in IMG/M
3300015309\|Ga0182098_1043399	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	729	Open in IMG/M
3300015309\|Ga0182098_1056285	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	670	Open in IMG/M
3300015310\|Ga0182162_1107149	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	541	Open in IMG/M
3300015311\|Ga0182182_1085194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	574	Open in IMG/M
3300015312\|Ga0182168_1081105	Not Available	618	Open in IMG/M
3300015316\|Ga0182121_1040138	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	826	Open in IMG/M
3300015318\|Ga0182181_1062545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	623	Open in IMG/M
3300015319\|Ga0182130_1053366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	706	Open in IMG/M
3300015319\|Ga0182130_1091267	Not Available	587	Open in IMG/M
3300015319\|Ga0182130_1138543	Not Available	501	Open in IMG/M
3300015320\|Ga0182165_1025065	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	955	Open in IMG/M
3300015324\|Ga0182134_1099475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	589	Open in IMG/M
3300015324\|Ga0182134_1100000	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	587	Open in IMG/M
3300015325\|Ga0182148_1129213	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	528	Open in IMG/M
3300015326\|Ga0182166_1143557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	505	Open in IMG/M
3300015327\|Ga0182114_1081138	Not Available	666	Open in IMG/M
3300015327\|Ga0182114_1108734	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	595	Open in IMG/M
3300015330\|Ga0182152_1036158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	864	Open in IMG/M
3300015330\|Ga0182152_1043769	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	809	Open in IMG/M
3300015330\|Ga0182152_1122562	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	553	Open in IMG/M
3300015330\|Ga0182152_1150040	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	509	Open in IMG/M
3300015333\|Ga0182147_1160913	Not Available	514	Open in IMG/M
3300015334\|Ga0182132_1087671	Not Available	661	Open in IMG/M
3300015339\|Ga0182149_1026343	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1021	Open in IMG/M
3300015340\|Ga0182133_1182877	Not Available	513	Open in IMG/M
3300015349\|Ga0182185_1105808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	812	Open in IMG/M
3300015349\|Ga0182185_1257480	Not Available	532	Open in IMG/M
3300015350\|Ga0182163_1208612	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	612	Open in IMG/M
3300015350\|Ga0182163_1228144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	584	Open in IMG/M
3300015350\|Ga0182163_1297641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	504	Open in IMG/M
3300015352\|Ga0182169_1071797	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1077	Open in IMG/M
3300015352\|Ga0182169_1129306	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	819	Open in IMG/M
3300015352\|Ga0182169_1193278	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	665	Open in IMG/M
3300015352\|Ga0182169_1221259	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	618	Open in IMG/M
3300015352\|Ga0182169_1255061	Not Available	569	Open in IMG/M
3300015353\|Ga0182179_1116186	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	813	Open in IMG/M
3300015353\|Ga0182179_1179632	Not Available	668	Open in IMG/M
3300015353\|Ga0182179_1208860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	623	Open in IMG/M
3300015353\|Ga0182179_1216254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	613	Open in IMG/M
3300015353\|Ga0182179_1237880	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	585	Open in IMG/M
3300015353\|Ga0182179_1262610	Not Available	558	Open in IMG/M
3300015353\|Ga0182179_1309936	Not Available	514	Open in IMG/M
3300015354\|Ga0182167_1154596	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	846	Open in IMG/M
3300015354\|Ga0182167_1160715	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	828	Open in IMG/M
3300015354\|Ga0182167_1260790	Not Available	623	Open in IMG/M
3300015354\|Ga0182167_1281948	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	593	Open in IMG/M
3300017412\|Ga0182199_1031353	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	997	Open in IMG/M
3300017412\|Ga0182199_1117432	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	626	Open in IMG/M
3300017412\|Ga0182199_1201133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	506	Open in IMG/M
3300017414\|Ga0182195_1075113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	768	Open in IMG/M
3300017414\|Ga0182195_1102607	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	684	Open in IMG/M
3300017432\|Ga0182196_1099595	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	589	Open in IMG/M
3300017435\|Ga0182194_1029144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	928	Open in IMG/M
3300017435\|Ga0182194_1083029	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	634	Open in IMG/M
3300017439\|Ga0182200_1086745	Not Available	630	Open in IMG/M
3300017440\|Ga0182214_1101884	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	612	Open in IMG/M
3300017446\|Ga0182217_1071584	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	809	Open in IMG/M
3300017447\|Ga0182215_1120479	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	593	Open in IMG/M
3300017447\|Ga0182215_1131039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	572	Open in IMG/M
3300017692\|Ga0182210_1093687	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	643	Open in IMG/M
3300017694\|Ga0182211_1174883	Not Available	513	Open in IMG/M
3300020033\|Ga0182146_100732	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	993	Open in IMG/M
3300022465\|Ga0213505_106504	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	983	Open in IMG/M
3300028064\|Ga0268340_1079608	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	519	Open in IMG/M
3300028139\|Ga0268355_1010093	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	613	Open in IMG/M
3300028143\|Ga0268348_1014828	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600	Open in IMG/M
3300028248\|Ga0268312_1027287	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563	Open in IMG/M
3300028470\|Ga0268307_1011646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	637	Open in IMG/M
3300028475\|Ga0268327_1006289	Not Available	771	Open in IMG/M
3300028477\|Ga0268309_1005017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	761	Open in IMG/M
3300028523\|Ga0268313_1012328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	585	Open in IMG/M
3300032465\|Ga0214493_1064691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	869	Open in IMG/M
3300032469\|Ga0214491_1031126	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1242	Open in IMG/M
3300032490\|Ga0214495_1069128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	823	Open in IMG/M
3300032514\|Ga0214502_1011183	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2655	Open in IMG/M
3300032790\|Ga0314731_1081374	Not Available	522	Open in IMG/M
3300032916\|Ga0314734_1001176	All Organisms → cellular organisms → Bacteria	3003	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.08%
Environmental	Environmental	3.92%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.08%
Terrestrial	Environmental → Terrestrial	3.92%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	86.27%
Unclassified	Host-Associated → Plants → Unclassified	6.86%
Soil	Environmental → Terrestrial → Soil	3.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.96%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	86.27%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	6.86%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.96%
Loam	Environmental → Terrestrial → Soil → Loam	0.98%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	86.27%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	6.86%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	78.43%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	7.84%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	6.86%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.98%

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017446	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020033	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG	Host-Associated	Open in IMG/M
3300022465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032790	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F100268

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070702_1006742542	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	QIEPVHFPLGSEDWWAFEELADDMEMAAAAISEDVSIEAVIGNVFADD*
Ga0068859_1020991402	3300005617	Switchgrass Rhizosphere	LPLGGEDWWAFEELANDMEMAPTAISEDISIEAIIGNVFADD*
Ga0105250_101359842	3300009092	Switchgrass Rhizosphere	MGSENWWAFEELADDMEMAAAAISENVSIEAVIGNVFADD*
Ga0105249_120372451	3300009553	Switchgrass Rhizosphere	DLLQFEPVLPLGSEDWLVFEELADDMEMAAAAISEDVSIEAVIGNVFADD*
Ga0105129_1128491	3300009975	Switchgrass Associated	SGSEDWLAFEDLADDMRMAATAISEDVSIEAIIGNIFADD*
Ga0105135_1004751	3300009980	Switchgrass Associated	LQVEPVHLPLGGKDWWAFEELADDMEMAATAISEEVSIEAVIDNVFADD*
Ga0105135_1182972	3300009980	Switchgrass Associated	LGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNIFADD*
Ga0105120_10565751	3300009992	Switchgrass Associated	LPLGIEDWWVFEELVEDMEMAAATISEDVSIEVVIGNVFADD*
Ga0105126_10344902	3300009994	Switchgrass Associated	LQIEPVHFPLGSEDWWALEELTDDMEMAAAAISEDVSIEAVIGNVFADD*
Ga0105126_10556741	3300009994	Switchgrass Associated	INLPLGGEDWWVFEELADDMEMAATAISEDIIIEAIIGNVFADD*
Ga0105139_10195474	3300009995	Switchgrass Associated	VHLPLGSEDWWVFEELADDMEMAAAAISEDVSIEAVIGNIFADD*
Ga0134125_108764602	3300010371	Terrestrial Soil	LGSEDWWVFEELTDDMEMAVAATSEDVSIEVVIGNVFADD*
Ga0134121_113822932	3300010401	Terrestrial Soil	WVFEELADDMERTAAAISEDVGIEAVIGNIFADD*
Ga0134123_112001372	3300010403	Terrestrial Soil	DWWVFEELADDMEMAAAAISEDVSIEAVIGNVFADD*
Ga0182183_10079682	3300015270	Switchgrass Phyllosphere	VETINLPLGGEDWWVFEELADDMEMAATAISEDIIIEVIIGNVFAND*
Ga0182183_10137223	3300015270	Switchgrass Phyllosphere	LQVEPVHLPLGSEDWWAFKEHADDMEMTATAISEEVSIEAVIDNVFADD*
Ga0182183_10744811	3300015270	Switchgrass Phyllosphere	SGHDFLQVEPVHLPLGYEDWWAFEELADDIEMAATAISEDISIEAIIGNIFADD*
Ga0182102_10033771	3300015273	Switchgrass Phyllosphere	SEDWWAFEELADDMEMVAAAISEDVSIEEVIGNVFADD*
Ga0182102_10108792	3300015273	Switchgrass Phyllosphere	HIPRGSEDWLAFEELTDDIEMAAAAISEDVSIEAVIGNVFGDD*
Ga0182101_10493282	3300015284	Switchgrass Phyllosphere	VEPVHLPLGGEDWWAFEELADDMEMAATAISEDISIEAIIGNVFADD*
Ga0182105_10228011	3300015290	Switchgrass Phyllosphere	KDWWAFEELADDMEMATTAISKDISIEAIIDNVFADD*
Ga0182105_10683242	3300015290	Switchgrass Phyllosphere	PLGGEDWWAFEELADDIEMAATAISEDISIEAIIGNVFADD*
Ga0182105_10972711	3300015290	Switchgrass Phyllosphere	MGSENWWAFEELADDMEMAAAAISENISIEAVIGNIFVDD*
Ga0182103_10760521	3300015293	Switchgrass Phyllosphere	FLQIEPVHFPLGSEDWWSFEEFTDDMEMVAAAISEDVSIEAVIGNVFADD*
Ga0182184_10731091	3300015301	Switchgrass Phyllosphere	PGSEDWLAFEDLADDMKMAATAISEDVSIEAIIGNVFADD*
Ga0182098_10433992	3300015309	Switchgrass Phyllosphere	SEDWWIFEELTDDMEMAAAAMFEDVSIEAVIGNVFAND*
Ga0182098_10562851	3300015309	Switchgrass Phyllosphere	DWWAFGELADDMEMAAAAISEDISIEAVIGNVFADD*
Ga0182162_11071492	3300015310	Switchgrass Phyllosphere	DWWAFEELADDMEMAATAISEDISIKAIIGNVFADD*
Ga0182182_10851941	3300015311	Switchgrass Phyllosphere	DWWALEEIADDREMAATAISEDISIEAIIGNVFADD*
Ga0182168_10811052	3300015312	Switchgrass Phyllosphere	VETINLPLGGEDWWVFVELADDMEMAATAISEDIIIEAIIGNVFADD*
Ga0182121_10401382	3300015316	Switchgrass Phyllosphere	HFPPGSEDWLAFEDLANDMKMAATAISEDISIEAIIGNIFADD*
Ga0182181_10625451	3300015318	Switchgrass Phyllosphere	LQVEPVHLSLGSEDWWAFEELADDMEMAAAAISEDVSIEAVIGNVFADN*
Ga0182130_10533662	3300015319	Switchgrass Phyllosphere	LGSEDWWAFEELADDMEMAAAAISADVSIEAVIGNVFADD*
Ga0182130_10912671	3300015319	Switchgrass Phyllosphere	WWVFKELADDMEMAAAAISEDVCIEAVIGNVFADD*
Ga0182130_11385431	3300015319	Switchgrass Phyllosphere	LWEEFEELVDDMEMAVAAISEDVSIEAIIGNLFADE*
Ga0182165_10250651	3300015320	Switchgrass Phyllosphere	LGGEDWWIFLELIDDMEMAAAAITEDVSIEAVIGNVFADN*
Ga0182134_10994751	3300015324	Switchgrass Phyllosphere	GGEDWWIFLELIDDMEMAAAAITEDVSIEAVIGNVFADD*
Ga0182134_11000001	3300015324	Switchgrass Phyllosphere	EPVHFPLGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNVFAND*
Ga0182148_11292131	3300015325	Switchgrass Phyllosphere	WWAFEELTEDMEMAATAISEDISIEAIIGNVFADD*
Ga0182166_11435571	3300015326	Switchgrass Phyllosphere	EPVHPLLGSEDWWVFEEITNDMEMAAAAISEDVIIEAVIGNIFADD*
Ga0182114_10811381	3300015327	Switchgrass Phyllosphere	LQVELVHFPLGSEDWWAFEELADDMEMAAAAISEHVSIEAIIGNVFADN*
Ga0182114_11087342	3300015327	Switchgrass Phyllosphere	QVEPVHLLLGSEDWWVFEELADDMEMAAAAISEDVSIEAIIGNVFCQ*
Ga0182152_10361582	3300015330	Switchgrass Phyllosphere	VEPVNLPLGGEDWWVFEELADDMEMAATTISEDISIEAIIGNFFADD*
Ga0182152_10437692	3300015330	Switchgrass Phyllosphere	GGEDWWAFEELADDMEMAATVISEEISIEAIVGNVFADD*
Ga0182152_11225622	3300015330	Switchgrass Phyllosphere	VEPAHFPQGSEDWLAFEDLANDMEMAAAAISADVSIEAIIGNVFADD*
Ga0182152_11500401	3300015330	Switchgrass Phyllosphere	ELFHFPLGSENWWAFEELADDMEMAAAAISVNVSIETVIGNVFADD*
Ga0182147_11609132	3300015333	Switchgrass Phyllosphere	DFLQVEPVHLPLGYEDWWAFEELADDMEMAATAISKDISIEAIIGNVFADD*
Ga0182132_10876712	3300015334	Switchgrass Phyllosphere	VELVHLPLGGEDWWAFEELADDMEMAATAISEDISIEAIIGNVFADD*
Ga0182149_10263431	3300015339	Switchgrass Phyllosphere	AHFPSGSEDWLAFEDLADDMKMAAAAISEDVSLEAIVGNVFADD*
Ga0182133_11828771	3300015340	Switchgrass Phyllosphere	VETINLPLGGEDWWVFEELADDMEMAATAISEDISIEAIIGNVFADD*
Ga0182185_11058082	3300015349	Switchgrass Phyllosphere	QVEPVQLPLGGEDWWIFLELIDDMEMAAAAITEDVSIEAVIGNVFADD*
Ga0182185_12574802	3300015349	Switchgrass Phyllosphere	LQVEPVHLPLGSEDWWAFKEHADDMEMAATAISEEVSIEAVIGNVFADD*
Ga0182163_12086121	3300015350	Switchgrass Phyllosphere	PIYLPLGGEDWWAFEELADDMEMAATVISENISIEAIIGNVFADD*
Ga0182163_12281441	3300015350	Switchgrass Phyllosphere	WAFEELTDDMEMAAAAISEDVSIEAVIGNVFTND*
Ga0182163_12976411	3300015350	Switchgrass Phyllosphere	LPLGSEDWWIFEELTDDMEMAAAAMFEDVSIEAVIGNVFADD*
Ga0182169_10717971	3300015352	Switchgrass Phyllosphere	PLGSEDWWAFEELTDDMEMAACAISEEVSIEAVIGNVFADD*
Ga0182169_11293062	3300015352	Switchgrass Phyllosphere	GHDFLQVELVHLPLGGEDWWAFEELADDMEMAATAISEDITINAIIGNVFADD*
Ga0182169_11932782	3300015352	Switchgrass Phyllosphere	VELVHLPLGGEDWWALEELADDMEMAATAISEDISIEA
Ga0182169_12212592	3300015352	Switchgrass Phyllosphere	VEPVHLPLGGEDWWAFEELADDMEMAATAISEDISIEVIIGKVFADD*
Ga0182169_12550613	3300015352	Switchgrass Phyllosphere	LGSEDWWVFEELADDMNAIFADVSIEAVIGNVFADD*
Ga0182179_11161863	3300015353	Switchgrass Phyllosphere	INLPLGGEDWWVFEEIADDMEMAATTISEDISIEAIIGNFFADD*
Ga0182179_11796321	3300015353	Switchgrass Phyllosphere	VEPVNLPLGGEDWWVFEELADDMEMAATAISEDIIIEVIIGNVFADD*
Ga0182179_12088601	3300015353	Switchgrass Phyllosphere	DFLQVEPVHLPLGGEDWWAFEELADDMDMAATAISEDISIEAIIGNVIAND*
Ga0182179_12162542	3300015353	Switchgrass Phyllosphere	LQVEPVHLPLGSEDWWAFKELADDMEMAATAISEEVSIEAVIDNVFADD*
Ga0182179_12378801	3300015353	Switchgrass Phyllosphere	LQVEPVNVPLGGEDWWAFEELADDMEMAATAISKDISIEAIIGNVFADD*
Ga0182179_12626102	3300015353	Switchgrass Phyllosphere	EPVHFPLGSEDWWALEELTDDMEMAAATISKDVSIEAVIGNVFADD*
Ga0182179_13099362	3300015353	Switchgrass Phyllosphere	LGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNVFTDD*
Ga0182167_11545961	3300015354	Switchgrass Phyllosphere	EPVNLPLGGEDWWAFEELADDMEMVATAISEDISIEAIIGNVFADD*
Ga0182167_11607151	3300015354	Switchgrass Phyllosphere	EDWWAVEELADDMEMAAVAISEDISIEAVIGNVFADD*
Ga0182167_12607901	3300015354	Switchgrass Phyllosphere	VELVHLPLGGEDWWAFEELADDMEMAATTISEDISIEAIIGNVFADD*
Ga0182167_12819482	3300015354	Switchgrass Phyllosphere	EPIHLPLGGKAWWAFEELADDMEMAATAISEEISIEAIIGNVFADD*
Ga0182199_10313531	3300017412	Switchgrass Phyllosphere	VELVHLPLGGEDWWAFEELADDMEMAATAISEDISIEAIIGNVFADD
Ga0182199_11174321	3300017412	Switchgrass Phyllosphere	EQVHFPLGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNVFADD
Ga0182199_12011331	3300017412	Switchgrass Phyllosphere	GGEDWWIFQELIYDMEMAAAAISEDVSIEAVIGNVFADD
Ga0182195_10751132	3300017414	Switchgrass Phyllosphere	VELVRLPLGDKDWWAFEELADNMEMAATAISEDISIEAIIGNVIAND
Ga0182195_11026072	3300017414	Switchgrass Phyllosphere	LQVEPVHFSLGSEDWWAFEEFTDDMEMAAAAISEDVSIEAVIGNVFADD
Ga0182196_10995951	3300017432	Switchgrass Phyllosphere	EWEEFEELADDMEMEAVAISEDVSIEAIIGNVFADE
Ga0182194_10291442	3300017435	Switchgrass Phyllosphere	LFHFPLGSENWWAFEELADDMEMAAAAISVNVSIETVIGNVFADD
Ga0182194_10830292	3300017435	Switchgrass Phyllosphere	GHDFLQIEPVHFPLGSEDWWAFEELSDDMEMAAAAISEDVSIEAVIGNVSADD
Ga0182200_10867452	3300017439	Switchgrass Phyllosphere	VETINLPLGGEDWWVFEELADDMEMAATAISEDISIEAIIGNVFADD
Ga0182214_11018842	3300017440	Switchgrass Phyllosphere	PTHFPPGSEDWLAFEDLADDMKMAAAAISEDVSIEAIIGDVFADD
Ga0182217_10715842	3300017446	Switchgrass Phyllosphere	MGSENWWAFEELADDMEMAAAAISENVSIEAVIGNVFADD
Ga0182215_11204791	3300017447	Switchgrass Phyllosphere	LQVEPVHLSLGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNVFVDD
Ga0182215_11310391	3300017447	Switchgrass Phyllosphere	LPLGSEDWWAFEELTDDMEMAAATISEDVSIEAVISNVFADD
Ga0182210_10936872	3300017692	Switchgrass Phyllosphere	HDLLQVEPFHFPLGSENWWAFEELVDDIEMAAAAISENVSIEAVIGNVFADD
Ga0182211_11748831	3300017694	Switchgrass Phyllosphere	LRVEPVHLLLDSEDWWAFEELADDMEMAAAAISEDVSIEVVISNVFAND
Ga0182146_1007321	3300020033	Switchgrass Phyllosphere	VHFPLGSEDWWVFEELTDDMEMAAAAISEDVSIEVVIGNVFADD
Ga0213505_1065042	3300022465	Switchgrass Phyllosphere	LQVEPVHLPLGSEDWWAFEELADDMEMVAAAISEDVSIEEGIGNVFADD
Ga0268340_10796082	3300028064	Phyllosphere	DWWVFEELADDMEMAATTISEDVSIEAVIGNVFADD
Ga0268355_10100931	3300028139	Phyllosphere	FPLGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNVFADD
Ga0268348_10148281	3300028143	Phyllosphere	SGHDFSQVELTHFPPGSEDWLAFEDLADDMKMAATAISEDVRIEAIIGNVFADD
Ga0268312_10272872	3300028248	Phyllosphere	PLGSEDWWVFEELTDDMEMAAAAISEDVSIEAVIGNVFADD
Ga0268307_10116461	3300028470	Phyllosphere	LQVEPVHLPLGSEDWWVFEELADDMEMAAAAISADVSIEAVIGNVFADD
Ga0268327_10062891	3300028475	Phyllosphere	VHPLLGSEDWWVFEELADDMEMAAAAISEDVSIEAVIGNVFADD
Ga0268309_10050171	3300028477	Phyllosphere	LLQVEQVHFPLGSEDWWAFEELTDDMEMAAAAISEDVSIEAVIGNVFADD
Ga0268313_10123282	3300028523	Phyllosphere	VEPVHLPLRSEDWWAFEELADDMEMAAAAISEDVSIEAVIGNVFADD
Ga0214493_10646912	3300032465	Switchgrass Phyllosphere	LQVEPVHLPLGSEDWWAFEELADDMEMVAAAISEDVSIEAVIGNVFADD
Ga0214491_10311261	3300032469	Switchgrass Phyllosphere	LQVEPVHLPLGSEDWWAFEELADDMEMVAAAISEDVSIEAVVGNVFADD
Ga0214495_10691283	3300032490	Switchgrass Phyllosphere	LGSKDWWVFEELADDMEMAAAAISEDISIDAVIGNVFTDD
Ga0214502_10111836	3300032514	Switchgrass Phyllosphere	LQVEPVHLPLGSEDWWAFEELADDMEMVAAAISEDVSIEEVIGNVFADD
Ga0314731_10813741	3300032790	Switchgrass Phyllosphere	DLLQVDPVHFSLGSEDWRAFEELADDMEMAAAAISKDVSIEAVIGNVFADD
Ga0314734_10011761	3300032916	Switchgrass Phyllosphere	LPLGSKDWWVFEELADDMEMAAAAISEDISIEAVIGNVFTDD

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign