NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099834

Metagenome Family F099834

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099834
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 46 residues
Representative Sequence ARRRGTALPRFSVEAYRRINSAEAHLVVLIVFVAAFMARGAWLF
Number of Associated Samples 90
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.88 %
% of genes near scaffold ends (potentially truncated) 93.20 %
% of genes from short scaffolds (< 2000 bps) 91.26 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.786 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(8.738 % of family members)
Environment Ontology (ENVO) Unclassified
(31.068 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.573 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 43.06%    β-sheet: 0.00%    Coil/Unstructured: 56.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF09980DUF2214 9.71
PF00027cNMP_binding 3.88
PF08281Sigma70_r4_2 2.91
PF02086MethyltransfD12 2.91
PF02518HATPase_c 2.91
PF13185GAF_2 2.91
PF07394DUF1501 1.94
PF07883Cupin_2 1.94
PF07676PD40 1.94
PF08450SGL 1.94
PF02397Bac_transf 1.94
PF00583Acetyltransf_1 1.94
PF06965Na_H_antiport_1 1.94
PF04069OpuAC 1.94
PF13432TPR_16 1.94
PF05163DinB 0.97
PF00005ABC_tran 0.97
PF01590GAF 0.97
PF13692Glyco_trans_1_4 0.97
PF08002DUF1697 0.97
PF02321OEP 0.97
PF13450NAD_binding_8 0.97
PF12704MacB_PCD 0.97
PF02687FtsX 0.97
PF07730HisKA_3 0.97
PF07690MFS_1 0.97
PF13231PMT_2 0.97
PF00326Peptidase_S9 0.97
PF10518TAT_signal 0.97
PF13620CarboxypepD_reg 0.97
PF00486Trans_reg_C 0.97
PF02771Acyl-CoA_dh_N 0.97
PF03781FGE-sulfatase 0.97
PF04542Sigma70_r2 0.97
PF02922CBM_48 0.97
PF11578DUF3237 0.97
PF00127Copper-bind 0.97
PF00275EPSP_synthase 0.97
PF05235CHAD 0.97
PF03551PadR 0.97
PF00795CN_hydrolase 0.97
PF00196GerE 0.97
PF00106adh_short 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0338DNA-adenine methylaseReplication, recombination and repair [L] 2.91
COG3392Adenine-specific DNA methylaseReplication, recombination and repair [L] 2.91
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.94
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 1.94
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.94
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 1.94
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.94
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 0.97
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.97
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.97
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.97
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.97
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.97
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 0.97
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 0.97
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.97
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.97
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.97
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.97
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.97
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.97
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.97
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.97
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.79 %
UnclassifiedrootN/A26.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_12979446Not Available631Open in IMG/M
3300001431|F14TB_100688107All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300004463|Ga0063356_100986366All Organisms → cellular organisms → Bacteria → Proteobacteria1201Open in IMG/M
3300004463|Ga0063356_102921042All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005179|Ga0066684_10288973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1086Open in IMG/M
3300005330|Ga0070690_100419569All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300005332|Ga0066388_106635522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300005364|Ga0070673_100194188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1745Open in IMG/M
3300005364|Ga0070673_101127426All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas gingeri733Open in IMG/M
3300005451|Ga0066681_10651501All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300005467|Ga0070706_101633107All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005467|Ga0070706_101929243Not Available536Open in IMG/M
3300005471|Ga0070698_100031884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5462Open in IMG/M
3300005518|Ga0070699_101195052All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300005560|Ga0066670_10194289All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300005576|Ga0066708_10812485Not Available586Open in IMG/M
3300005598|Ga0066706_10589450All Organisms → cellular organisms → Bacteria → Proteobacteria883Open in IMG/M
3300005617|Ga0068859_101053366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300005764|Ga0066903_103495129All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp.847Open in IMG/M
3300005764|Ga0066903_107635009Not Available557Open in IMG/M
3300005842|Ga0068858_102592715All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300005843|Ga0068860_102047289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Armatimonadales → Armatimonadaceae → Armatimonas → Armatimonas rosea594Open in IMG/M
3300005844|Ga0068862_102085346All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300006169|Ga0082029_1126847All Organisms → cellular organisms → Bacteria → Proteobacteria641Open in IMG/M
3300006358|Ga0068871_100620346All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300006796|Ga0066665_10611470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium874Open in IMG/M
3300006852|Ga0075433_10595010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14971Open in IMG/M
3300006854|Ga0075425_100799164All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300007076|Ga0075435_100035974All Organisms → cellular organisms → Bacteria3932Open in IMG/M
3300007076|Ga0075435_100384882All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_91205Open in IMG/M
3300007258|Ga0099793_10646885All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009100|Ga0075418_10083004All Organisms → cellular organisms → Bacteria → Proteobacteria3408Open in IMG/M
3300009137|Ga0066709_103392667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales579Open in IMG/M
3300009148|Ga0105243_11593166Not Available679Open in IMG/M
3300009148|Ga0105243_12195688All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300009162|Ga0075423_10985630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300009162|Ga0075423_11780592All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300009176|Ga0105242_10097652All Organisms → cellular organisms → Bacteria2483Open in IMG/M
3300009176|Ga0105242_10102985All Organisms → cellular organisms → Bacteria2421Open in IMG/M
3300009553|Ga0105249_11066375All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300009610|Ga0105340_1437760Not Available584Open in IMG/M
3300009803|Ga0105065_1049136All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300010036|Ga0126305_10614031Not Available732Open in IMG/M
3300010037|Ga0126304_10798271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hirsutus640Open in IMG/M
3300010039|Ga0126309_11166408Not Available527Open in IMG/M
3300010043|Ga0126380_11660714Not Available572Open in IMG/M
3300010166|Ga0126306_10618973All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300010323|Ga0134086_10172384All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300010333|Ga0134080_10439103All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300010358|Ga0126370_10324892All Organisms → cellular organisms → Bacteria → Acidobacteria1232Open in IMG/M
3300010362|Ga0126377_11376527All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300010366|Ga0126379_13882640Not Available500Open in IMG/M
3300010398|Ga0126383_10789952All Organisms → cellular organisms → Bacteria → Acidobacteria1032Open in IMG/M
3300010398|Ga0126383_11667272Not Available727Open in IMG/M
3300010398|Ga0126383_12075969All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13655Open in IMG/M
3300010399|Ga0134127_11841057Not Available682Open in IMG/M
3300010401|Ga0134121_11795776All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300011270|Ga0137391_10431279All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1123Open in IMG/M
3300012210|Ga0137378_11403750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300012354|Ga0137366_10315828All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300012357|Ga0137384_10427134All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300012362|Ga0137361_11195410All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300012363|Ga0137390_10321174All Organisms → cellular organisms → Bacteria → Acidobacteria1529Open in IMG/M
3300012469|Ga0150984_113226005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300012922|Ga0137394_10296146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_211383Open in IMG/M
3300012971|Ga0126369_11417874Not Available785Open in IMG/M
3300014326|Ga0157380_12413344All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300014965|Ga0120193_10070458All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300015200|Ga0173480_10333775All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium859Open in IMG/M
3300015358|Ga0134089_10489409All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300015371|Ga0132258_10211649All Organisms → cellular organisms → Bacteria4710Open in IMG/M
3300015371|Ga0132258_12340647All Organisms → cellular organisms → Bacteria → Acidobacteria1339Open in IMG/M
3300015373|Ga0132257_104467648All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300016341|Ga0182035_11123542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300016422|Ga0182039_11215019Not Available681Open in IMG/M
3300018027|Ga0184605_10527509Not Available511Open in IMG/M
3300025899|Ga0207642_11163759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300025910|Ga0207684_10983177Not Available707Open in IMG/M
3300025922|Ga0207646_11412736Not Available605Open in IMG/M
3300025934|Ga0207686_10042268All Organisms → cellular organisms → Bacteria2785Open in IMG/M
3300025942|Ga0207689_10587631Not Available936Open in IMG/M
3300025942|Ga0207689_11523500All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium558Open in IMG/M
3300026075|Ga0207708_10670714All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300026142|Ga0207698_12016944Not Available591Open in IMG/M
3300027903|Ga0209488_10609041All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300028379|Ga0268266_10828558All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300028812|Ga0247825_10000119All Organisms → cellular organisms → Bacteria43916Open in IMG/M
3300031547|Ga0310887_10229382All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1026Open in IMG/M
3300031547|Ga0310887_11014780Not Available530Open in IMG/M
3300031562|Ga0310886_10813781Not Available589Open in IMG/M
3300031682|Ga0318560_10387221Not Available756Open in IMG/M
3300031770|Ga0318521_10980288Not Available518Open in IMG/M
3300031794|Ga0318503_10010439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2428Open in IMG/M
3300031854|Ga0310904_10226384All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300031894|Ga0318522_10086299Not Available1151Open in IMG/M
3300031910|Ga0306923_11584536All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300031942|Ga0310916_11398618Not Available573Open in IMG/M
3300031947|Ga0310909_10261632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1447Open in IMG/M
3300032052|Ga0318506_10220976Not Available837Open in IMG/M
3300032076|Ga0306924_11626879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300032180|Ga0307471_100356325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1575Open in IMG/M
3300032261|Ga0306920_101559621Not Available941Open in IMG/M
3300033482|Ga0316627_101529827All Organisms → cellular organisms → Bacteria676Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.94%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.97%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1297944613300000550SoilIRVRAARRSGQPLPRFPLEAYRRINSVEIALVVIIVIVAAFMARGAWLF*
F14TB_10068810733300001431SoilITFIRVRSARRNRTALPAFSVDAYRTINSVEIALVVTIVFVAAFMARGAWLF*
Ga0063356_10098636633300004463Arabidopsis Thaliana RhizosphereAPMTTFIRIRAARRGGAPLPSFPLAVYRRINAVEGMLLVAIVFAAAFMARGAWLF*
Ga0063356_10292104213300004463Arabidopsis Thaliana RhizospherePMMTFMRVRSARRRRAALPQFPVEAYRRINSAEIVLVVAIVFAAAFMVRGVWLF*
Ga0066684_1028897313300005179SoilMRNGTTLPQFPVAVFRRINSAEIALVIAIVFTAAFMARGAWLF*
Ga0070690_10041956923300005330Switchgrass RhizosphereNRLAEHFLLELAPMTTFVRVRLARARGAPLPPFSIDSCRRVNAVELGLVVAIVFVAAFMARAAWMF*
Ga0066388_10663552223300005332Tropical Forest SoilRRQHAELPRFNVQVYAGINTAEVALVVTIVFVAAFMARGVWLF*
Ga0070673_10019418833300005364Switchgrass RhizosphereKHHTPLPRFSVEIYRRINSVELALVVTIVFVAAFMARGAWLF*
Ga0070673_10112742613300005364Switchgrass RhizosphereMTFIRVRVARKRGSPLPLFSVEVYRRINRAEVVLVAAIVIVAAFMARGAWLF*
Ga0066681_1065150113300005451SoilKTALPRFSAESLRRINSAETILVVAIVFIAAFMARGAWMF*
Ga0070706_10163310713300005467Corn, Switchgrass And Miscanthus RhizosphereTFIRVRSARSRHTPLPDFPLDVYRRINTAETALVIAIVFVAAFMARGAWLF*
Ga0070706_10192924313300005467Corn, Switchgrass And Miscanthus RhizosphereRRGAPLPPFPLATYRRINAAETALVVVIVFVAAFMARGAWML*
Ga0070698_10003188413300005471Corn, Switchgrass And Miscanthus RhizosphereRRQGVPFPPFPLATYRRINAVETALVVVIVFVAAFMARGAWML*
Ga0070699_10119505213300005518Corn, Switchgrass And Miscanthus RhizosphereARSKGMPVPRFPIDAYRRINAIELALVVAIVFVAAFMARGAWLF*
Ga0066670_1019428923300005560SoilMITFVRVRIARRKGLAPPAFSIETYRRINAVETALLVAIVFVAAFMARGAWLF*
Ga0066708_1081248513300005576SoilRRRGTALPRFPVEAYCRINSAEIVLVVAIVFAAAFTARGAWLF*
Ga0066706_1058945013300005598SoilMFIRVRLARRRSTALPHFSVEAYRRINAAELLLVVIIVFVAAFMARGAWLF*
Ga0068859_10105336623300005617Switchgrass RhizospherePRFSVEAYRRINTAEIVLVVAIVFAAAFMARGAWLF*
Ga0066903_10349512913300005764Tropical Forest SoilMMTFIRVRRARSKRLAVPHFPIETYRRINAAELALVIAIVIVAAFMARGAWLF*
Ga0066903_10763500923300005764Tropical Forest SoilPKFPLDIYRRINAVELWLVVAIVFVAAFMARGAWMF*
Ga0068858_10259271513300005842Switchgrass RhizosphereTALPRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF*
Ga0068860_10204728913300005843Switchgrass RhizosphereTALARGAALPEFPLGAYRRMNSGEVALVVAIVFVAAFMARGAWLF*
Ga0068862_10208534613300005844Switchgrass RhizosphereVRIARSKGLPLPRFSVEAYRRINAVEAGLVVIIVFAAAFMARGAWLF*
Ga0082029_112684713300006169Termite NestKRGLSFPPLPIESLRRINRAEMALVVIIVVVAAFMARGAWLLS*
Ga0068871_10062034623300006358Miscanthus RhizosphereTFMRVRAARRRKTELPRFSVETYSAINTAEVVLVITIVFVAAFMARGAWLF*
Ga0066665_1061147023300006796SoilPRFSLDAYRRINAAEVTLIVAIVFVAAFMARGAWLF*
Ga0075433_1059501013300006852Populus RhizosphereTFIRVRSARRRNAPLPRFSIEALGRINALELGIVVAIVFVAAFMARGAWLF*
Ga0075425_10079916413300006854Populus RhizosphereKKSAPLPGFPVETFRRINSAETALVVIIVFVAAFMARGAWLF*
Ga0075435_10003597463300007076Populus RhizospherePMATFVRVRAARRKGLPAPPFPVETYRRINAAELGLVVAIVVVAALMARGAWLF*
Ga0075435_10038488213300007076Populus RhizosphereRGRAAPLPRFSAETLRRINAAEVVLVVLIVFVAAFMARGAWLF*
Ga0099793_1064688523300007258Vadose Zone SoilTALPRFSAEAYRRINSAEVILVVTIVFVAAFMARGAWLF*
Ga0075418_1008300453300009100Populus RhizosphereAAIPRFSAARYRVLNTIELALVVSIVFVAALMTRGAWLF*
Ga0066709_10339266713300009137Grasslands SoilRAAPLPRFSAETFRRINAAETELVVLIVFVAAFMARGAWLF*
Ga0105243_1159316623300009148Miscanthus RhizosphereLEPSSLAGARRHQTALPRFSLETYRRINSAEMILVVAIVFVAAFMARGAWLF*
Ga0105243_1219568823300009148Miscanthus RhizosphereALPRFSVDAFRRINAAELALVVAIVFVAAFMARGAWLF*
Ga0075423_1098563013300009162Populus RhizosphereRAARRRRAALPRFSVEAYRRINSAEMILVVAIVFVAAFMARGAWLF*
Ga0075423_1178059223300009162Populus RhizosphereMMTFIRVRIAVARRMPLPRFSVETYRRINTAETALVVAIVFVAAFMARGVWLF*
Ga0105242_1009765213300009176Miscanthus RhizosphereARRGGKPLPDFSVARYRRINTAAAVLVIAIVFVAAFMARGAWLF*
Ga0105242_1010298553300009176Miscanthus RhizospherePRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF*
Ga0105249_1106637523300009553Switchgrass RhizosphereTFIRVRNARAKRTVLPRFPLDTYRRINAAELALVITIVFMAAFMARGAWMF*
Ga0105340_143776013300009610SoilMITFIRVRTARSKGSPLPKFSVEAYRRINAVELGLVVTIVFAAAFMARGAWLF*
Ga0105065_104913623300009803Groundwater SandQGVTVPQFSVDAYRRINAVELALVVTIVFVAAFMARGAWLF*
Ga0126305_1061403113300010036Serpentine SoilTTFIRVRAARRRGSPLPSFSIEAYRRINIAETTLVVVIVFVAAFMARGAWLF*
Ga0126304_1079827113300010037Serpentine SoilRGSSPPTVPVDACRRINHIETALVVVIVFVAAFIARGAWLF*
Ga0126309_1116640823300010039Serpentine SoilRTAWPRFPVETYRRINSAELVLVVIIVFVAAFMARGAWLF*
Ga0126380_1166071413300010043Tropical Forest SoilPMTTFMRVRRARRQKTALPQFPLDMYRRINKVEFGLVVTIVFVAAFMTRGAWMF*
Ga0126306_1061897313300010166Serpentine SoilMTTFIRVRAARRRGSPLPSFSIEAYRRINIAETTLVVVIVFVAAFMARGAWLF*
Ga0134086_1017238423300010323Grasslands SoilALPRFPVEAYCRINSAEIVLVVAIVFAAAFMARGAWLF*
Ga0134080_1043910313300010333Grasslands SoilIRVRRARSHGVAVPRFSIEAYRRINAAELALVVTIVFVAAFMARGAWLF*
Ga0126370_1032489213300010358Tropical Forest SoilRVRIAQSRGTAIPRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF*
Ga0126377_1137652713300010362Tropical Forest SoilMVTFIRVRSARALKAPPPRFRVETFRTINTIELALVVAIVFVAAFMARAAWLF*
Ga0126379_1388264023300010366Tropical Forest SoilFMRVRIAQSRGTAIPRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF*
Ga0126383_1078995213300010398Tropical Forest SoilPRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF*
Ga0126383_1166727213300010398Tropical Forest SoilTFVRVRAARRNRAALPAFSVEAYRTINSVEIALVVAIVFVAAFMARGAWMF*
Ga0126383_1207596913300010398Tropical Forest SoilMILLPRFSIETYRRINGIEERLVVSIVFVAAFMARGAWLF*
Ga0134127_1184105723300010399Terrestrial SoilELAPMVAFIRVRIARKRGLPLPRFSVYTFRRINQAETVLIMVIVIVAAFMVRGTWLF*
Ga0134121_1179577623300010401Terrestrial SoilARRRGTALPRFSVEAYRRINSAEAHLVVLIVFVAAFMARGAWLF*
Ga0137391_1043127913300011270Vadose Zone SoilAREPRAARGAPMPEFSVEAYRRINAVEVVPVVAIVFVAAFMARGAWLF*
Ga0137378_1140375013300012210Vadose Zone SoilTALPRFPLDAFRRINSAEIVLVVAIVFVAAFMARGAWLF*
Ga0137366_1031582833300012354Vadose Zone SoilMIFIRVRLARTRRTALPRFSVEAYRRINAAELVLVVIIVFVAAFMARGAWLF*
Ga0137384_1042713423300012357Vadose Zone SoilRFSVKAYRRINSAELVLVVVIVFVAAFMARGAWLF*
Ga0137361_1119541023300012362Vadose Zone SoilIRVRAARRRHTASPRFSIATYRRINAAEVVLVVAIVFAAAFMARGAWLF*
Ga0137390_1032117413300012363Vadose Zone SoilRFSVDAYRRINAAEVALVVAIVFVAAFMARGAWLF*
Ga0150984_11322600523300012469Avena Fatua RhizosphereFRSLARSRGTALPPFSIESYRRINAAELGLVVAIVFVAAFMARGAWLF*
Ga0137394_1029614623300012922Vadose Zone SoilMPMMSFIRVRAARRRHTALPRFSIATYRRINAAEVVLVVAIVFAAAFMARGAWLF*
Ga0126369_1141787413300012971Tropical Forest SoilRRRGTPLPQFSVAVYRRINALELALVVTIVFVAAFMARGAWLF*
Ga0157380_1241334423300014326Switchgrass RhizosphereLPRFSVEIYRRINSVELALVVTIVFVAAFMARGAWLF*
Ga0120193_1007045823300014965TerrestrialGAPLPPVPVAMYRRINAVETALVFLIVIVAAFMARGAWMI*
Ga0173480_1033377523300015200SoilGLPLPRFSVEAYRRINAVEAGLVVIIVFAAAFMARGAWLF*
Ga0134089_1048940913300015358Grasslands SoilPMTTFIRVRAALGRKTALPRFSAESLRRINSAETILVVAIVFIAALMARGSWMF*
Ga0132258_1021164923300015371Arabidopsis RhizosphereMVTFIRVRQARRRGSALPRFSVNACRRINNVEVALVVAIVFVAAFMARGAWLF*
Ga0132258_1234064713300015371Arabidopsis RhizosphereMRARTARVRGVALPRFSIVAYQRINAVELALVVAIVFVAAFMARGAWLF*
Ga0132257_10446764823300015373Arabidopsis RhizosphereRRKALPRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF*
Ga0182035_1112354213300016341SoilMRVRVAQSRGTAIPRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF
Ga0182039_1121501923300016422SoilPRFPVEAYRRINEIELALVIAIVFVAAFMARGAWLF
Ga0184605_1052750913300018027Groundwater SedimentRALPRFSVGTYRRINSAELVLVVTIVFVAAFMARGAWLF
Ga0207642_1116375913300025899Miscanthus RhizosphereRRSTALPRFSVEAYRRINTAEIVLVVAIVFAAAFMARGAWLF
Ga0207684_1098317723300025910Corn, Switchgrass And Miscanthus RhizosphereRSARRQGVPFPFPLATYRRINAVETALVVVIVFVAAFMARGAWML
Ga0207646_1141273613300025922Corn, Switchgrass And Miscanthus RhizosphereVARRMPLPRFSAETYRRINTAETALVVAIVFVAAFMARGLWLF
Ga0207686_1004226853300025934Miscanthus RhizosphereRTALPRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF
Ga0207689_1058763113300025942Miscanthus RhizosphereLPLFSVEVYRRINRAEVVLVAAIVIVAAFMARGAWLF
Ga0207689_1152350013300025942Miscanthus RhizosphereLPRFSNDLFRRINAAEVTLVVGIVFVAAFMARGTWLF
Ga0207708_1067071413300026075Corn, Switchgrass And Miscanthus RhizospherePMMTFIRVRAARRSGSSLPRFSVETLRRINAAELGLIVAIVFAAAFMARGAWLF
Ga0207698_1201694413300026142Corn RhizosphereSVAAYRRINTAETALLVVIVLVAALMARGAWLFTAFQN
Ga0209488_1060904113300027903Vadose Zone SoilVRAARRRHTASPRFSIATYRRINSAEVVLVVAIVFAAAFMARGAWLF
Ga0268266_1082855813300028379Switchgrass RhizosphereRAARGRQTTLPRFSIESLRRINAAELVLVVTIVFVAAFMARGAWLF
Ga0247825_10000119223300028812SoilLPQFSLEAFRLINTVELALVVAIVFVAAFMARGAWLF
Ga0310887_1022938223300031547SoilGSPLPKLSVEAYRRINAVELGLVVTIVFAAAFMARGAWLF
Ga0310887_1101478013300031547SoilSQAGGAAMPAFDVARYRRINAIEMRLVIAIPFAAALMARGAWLF
Ga0310886_1081378123300031562SoilGGAAMPAFDVARYRRINAIEMRLVIAIPFAAALMARGAWLF
Ga0318560_1038722123300031682SoilRARSQRSALPRFPVEAYRRINEIELALVIAIVFVAAFMARGAWLF
Ga0318521_1098028813300031770SoilMVTFIRVRVARGRGAPPPGFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF
Ga0318503_1001043943300031794SoilVRSARRRGEALPRFSVQMFRRINSAEVVLVVTIVFVAAFMARGAWLF
Ga0310904_1022638423300031854SoilKRTALPRFPLDTYRRINAAELALVITIVFMAAFMARGAWMF
Ga0318522_1008629913300031894SoilRSARRRGEALPRFSVQMFRRINSAEVVLVVTIVLVAAFMARGAWLF
Ga0306923_1158453613300031910SoilRVRVARGRGAPPPEFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF
Ga0310916_1139861823300031942SoilVARGRGAPPPEFSVQTFRRINSVEVALIVCIVFVAAFMARGAWLF
Ga0310909_1026163223300031947SoilAPPPEFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF
Ga0318506_1022097613300032052SoilFIRVRSARRRGEALPRFSVQMFRRINSAEVVLVVTIVFVAAFMARGAWLF
Ga0306924_1162687923300032076SoilTFIRVRVARGRGAPPPEFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF
Ga0307471_10035632543300032180Hardwood Forest SoilMTTFIRARQARRKHADMPRFPVDIYRRINAAELALVVVIVFVAAFMARGTWLF
Ga0306920_10155962123300032261SoilALPRFPLAAYRRINAAEVVFVIAIVFAAAFMARGAWLF
Ga0316627_10152982713300033482SoilRTARRRGTALPVFSVDAFRLINSIETALVIAIVFVAAFMARGAWLF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.