NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099817

Metagenome / Metatranscriptome Family F099817

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099817
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 43 residues
Representative Sequence MNPDNQQAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS
Number of Associated Samples 102
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 45.63 %
% of genes from short scaffolds (< 2000 bps) 89.32 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.563 % of family members)
Environment Ontology (ENVO) Unclassified
(28.155 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.544 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.23%    β-sheet: 0.00%    Coil/Unstructured: 95.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00535Glycos_transf_2 74.76
PF09334tRNA-synt_1g 6.80
PF00590TP_methylase 0.97
PF13231PMT_2 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.80
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.80
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.80
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.80
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.80
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_175016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1898Open in IMG/M
3300001867|JGI12627J18819_10237168All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300004114|Ga0062593_103290722All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300004801|Ga0058860_10872762All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005167|Ga0066672_10018047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3627Open in IMG/M
3300005171|Ga0066677_10764384All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005174|Ga0066680_10462769All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005176|Ga0066679_10719807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales645Open in IMG/M
3300005179|Ga0066684_10402909All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300005186|Ga0066676_10919876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales586Open in IMG/M
3300005363|Ga0008090_15722124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales739Open in IMG/M
3300005445|Ga0070708_100602708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1035Open in IMG/M
3300005457|Ga0070662_100060340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae2765Open in IMG/M
3300005471|Ga0070698_100135800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae2413Open in IMG/M
3300005555|Ga0066692_10436219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura833Open in IMG/M
3300005618|Ga0068864_100289186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1532Open in IMG/M
3300006172|Ga0075018_10151645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1069Open in IMG/M
3300006755|Ga0079222_11387451All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300006796|Ga0066665_10863170All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300006854|Ga0075425_102855715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae531Open in IMG/M
3300006914|Ga0075436_100324897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1105Open in IMG/M
3300006953|Ga0074063_10040677All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300007258|Ga0099793_10250130All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300007265|Ga0099794_10088661All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300009012|Ga0066710_102189282All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300010096|Ga0127473_1089859All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300010120|Ga0127451_1136100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300010134|Ga0127484_1094350All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010136|Ga0127447_1070789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae508Open in IMG/M
3300010323|Ga0134086_10426613All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300010360|Ga0126372_13155955All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300010366|Ga0126379_12425869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300010877|Ga0126356_10009435All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300011106|Ga0151489_1005879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp.1399Open in IMG/M
3300011120|Ga0150983_15662946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1334Open in IMG/M
3300012285|Ga0137370_10758577All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300012362|Ga0137361_10643759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura970Open in IMG/M
3300012372|Ga0134037_1130491All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300012374|Ga0134039_1032781All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012385|Ga0134023_1277644All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300012391|Ga0134035_1048768All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300012403|Ga0134049_1395681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales700Open in IMG/M
3300012489|Ga0157349_1004172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300012493|Ga0157355_1012848All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012495|Ga0157323_1021535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300012513|Ga0157326_1007141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp.1203Open in IMG/M
3300012683|Ga0137398_10887521All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012685|Ga0137397_10568330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300012927|Ga0137416_10503476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1043Open in IMG/M
3300012958|Ga0164299_10666354All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300016341|Ga0182035_10844616All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300017993|Ga0187823_10129638All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300018090|Ga0187770_11435391All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300019875|Ga0193701_1006962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2177Open in IMG/M
3300019877|Ga0193722_1122982All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300019883|Ga0193725_1143097All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300019885|Ga0193747_1121290All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300019887|Ga0193729_1083923All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300019890|Ga0193728_1147766All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300019890|Ga0193728_1191079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia867Open in IMG/M
3300020069|Ga0197907_10016432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1595Open in IMG/M
3300020081|Ga0206354_10915463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae4294Open in IMG/M
3300020579|Ga0210407_10066117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2710Open in IMG/M
3300020581|Ga0210399_10170293All Organisms → cellular organisms → Bacteria1805Open in IMG/M
3300021178|Ga0210408_10039828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3692Open in IMG/M
3300021432|Ga0210384_10218073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1716Open in IMG/M
3300021475|Ga0210392_10108886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1836Open in IMG/M
3300021560|Ga0126371_10293331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1751Open in IMG/M
3300022467|Ga0224712_10307271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M
3300022722|Ga0242657_1244859All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300025910|Ga0207684_10962640All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300025928|Ga0207700_10413768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1183Open in IMG/M
3300026494|Ga0257159_1063844All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300026547|Ga0209156_10300037All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300026552|Ga0209577_10650857All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300027108|Ga0207946_106538All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300027161|Ga0208368_109270All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300027671|Ga0209588_1254495All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300027775|Ga0209177_10047118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp.1207Open in IMG/M
3300028793|Ga0307299_10012652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2987Open in IMG/M
3300028876|Ga0307286_10158104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp.814Open in IMG/M
3300029636|Ga0222749_10253654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300030917|Ga0075382_11710497All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300031018|Ga0265773_1005784All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300031097|Ga0308188_1028891All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300031122|Ga0170822_16578224All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300031184|Ga0307499_10032014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1201Open in IMG/M
3300031469|Ga0170819_10432094All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300031543|Ga0318516_10248656All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300031549|Ga0318571_10089939All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300031680|Ga0318574_10245781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1034Open in IMG/M
3300031724|Ga0318500_10743843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae501Open in IMG/M
3300031799|Ga0318565_10286858All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300031820|Ga0307473_10301306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1009Open in IMG/M
3300031954|Ga0306926_10383828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1735Open in IMG/M
3300032039|Ga0318559_10139508All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300032180|Ga0307471_100631222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1232Open in IMG/M
3300032770|Ga0335085_10208450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2387Open in IMG/M
3300032782|Ga0335082_10105102All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300032805|Ga0335078_11997178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300032829|Ga0335070_10740039All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300032898|Ga0335072_11438148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae593Open in IMG/M
3300033475|Ga0310811_10239685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2161Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.91%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.97%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.97%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010096Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010120Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010136Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012372Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012374Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027108Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes)EnvironmentalOpen in IMG/M
3300027161Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031018Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031097Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_029668502199352025SoilMNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDPLTLKETKTWS
JGI12627J18819_1023716823300001867Forest SoilGLLCWPDGPNNEQAAGSVRSSLAYGITTRARDRFVPPDPLMVKETKTWS*
Ga0062593_10329072223300004114SoilMNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS*
Ga0058860_1087276213300004801Host-AssociatedAGLMNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS*
Ga0066672_1001804723300005167SoilMNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS*
Ga0066677_1076438423300005171SoilLLCWADEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS*
Ga0066680_1046276923300005174SoilVPSCTGLMNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS*
Ga0066679_1071980723300005176SoilMNPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS*
Ga0066684_1040290913300005179SoilMNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDPLTLKETKTWS*
Ga0066676_1091987623300005186SoilMNPDNQQAASSVRSSLAYGNTTRDQDRAVRPDPLTLKETKTWS*
Ga0008090_1572212423300005363Tropical Rainforest SoilMNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLTVKETKTWS*
Ga0070708_10060270823300005445Corn, Switchgrass And Miscanthus RhizosphereMNPDNQQAASSVRSSLAYGNTMRDQDWAIEADPLMLKETKTWS*
Ga0070662_10006034023300005457Corn RhizosphereMNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS*
Ga0070698_10013580013300005471Corn, Switchgrass And Miscanthus RhizosphereMNPDNQQAASSVRSSLAYGNTMRDPDWAIEADPLMLKETKTWS*
Ga0066692_1043621923300005555SoilMNPDNQQAASSVRSSLAYVNTMRDPDWAIEADPLMLKETKTWS*
Ga0068864_10028918623300005618Switchgrass RhizosphereMNPDNDQAAGSVRLSLAYGNTVRDQDRAIQAIPLTV*
Ga0075018_1015164523300006172WatershedsMNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS*
Ga0079222_1138745123300006755Agricultural SoilMNPDNQQAASSVRSSLAYGNTTRDLDWAMRPDPLTLNGDETWS*
Ga0066665_1086317023300006796SoilMSPDNQQAASSVRSSLAYGNTTRDQDWAMQPDPLTLKETKTWS*
Ga0075425_10285571523300006854Populus RhizosphereMNPDNQQAASAVRSSLAYGSTTHDLNWAIEADPQTLKETNVELTVVM
Ga0075436_10032489723300006914Populus RhizosphereMNPDNNKQPVSVRSSLAYGSTTRDQDWAIDEDPMTLKETKTWS*
Ga0074063_1004067723300006953SoilNEQAAGSVHSSPAYVNTLRDQDWARRPDPLTLKETKTWS*
Ga0099793_1025013023300007258Vadose Zone SoilMNPDNQQAASSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS*
Ga0099794_1008866123300007265Vadose Zone SoilMNPDNEQAASSVRSSLAYGNTRRDQDWASEADPLTVKETKTWS*
Ga0066710_10218928223300009012Grasslands SoilMNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS
Ga0127473_108985913300010096Grasslands SoilDEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS*
Ga0127451_113610013300010120Grasslands SoilMNPDNQQAASSVRSSPAYGNTTRDQDRAMRPDPLTLK
Ga0127484_109435023300010134Grasslands SoilNPDNQQAASSVRSSPAYGNTTRDQDRAMRPDPLTLKETKTWS*
Ga0127447_107078913300010136Grasslands SoilMNPVNNKQPVSVRSSLAYGSTTRDQDWAIDEDPMTLKETKTWS*
Ga0134086_1042661323300010323Grasslands SoilMNPDNQQAASSVRSSLAYGNTTRDQDWAMQPDPLTLKETKTWS*
Ga0126372_1315595523300010360Tropical Forest SoilMNPDNEQAASSVRSSPAYGNTTRDQDGANEADPLTVKETKTWS*
Ga0126379_1242586913300010366Tropical Forest SoilMNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLTVKET
Ga0126356_1000943513300010877Boreal Forest SoilAVPSCAGLMNPDNQQAASSARSSLAYGNTTRDQDWAIEADPQTLKETKTWS*
Ga0151489_100587913300011106SoilLMNPDNQQAASSVRSSLAYGSTTRDQDRAMRPDPLTLKETKTWS*
Ga0150983_1566294623300011120Forest SoilMNPDNKQAASSVRSSLAYGNTTRDPDWAIDEDPLTLKETKRWS*
Ga0137370_1075857723300012285Vadose Zone SoilAGQMNPDNQRAASSVRSSLAYVNTMRDPDWAIEADPLMLMETKTWS*
Ga0137361_1064375923300012362Vadose Zone SoilMNPDNEQAASSVRSSLAYGNTKRDQDWASEADPLTVKETKTWS*
Ga0134037_113049123300012372Grasslands SoilWADEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS*
Ga0134039_103278123300012374Grasslands SoilLMSPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS*
Ga0134023_127764413300012385Grasslands SoilMNPDNDQAAGSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS*
Ga0134035_104876823300012391Grasslands SoilMNPDNQQTASSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS*
Ga0134049_139568123300012403Grasslands SoilMNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETK
Ga0157349_100417223300012489Unplanted SoilMNPDNQHAASSVRSSIAYGNTTRDQDRAMRPDPLTLKETKTWS*
Ga0157355_101284823300012493Unplanted SoilMNPDNQQAASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS*
Ga0157323_102153523300012495Arabidopsis RhizosphereMNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKEMKTWS*
Ga0157326_100714123300012513Arabidopsis RhizosphereMNPDNQQAASSVRSSLAYGNTTRDLDWAMRPDPLTLKETKTWS*
Ga0137398_1088752113300012683Vadose Zone SoilMNPDNQQAASSVRSSPAYGNTTRDQDWAIEADPQTLKETKTWS*
Ga0137397_1056833023300012685Vadose Zone SoilMNPDNQQAASSVRSSLAYGSTTRDLDWAIDEDPLTLKETKTWS*
Ga0137416_1050347623300012927Vadose Zone SoilMNPDNQQAASSVRSSLAYGNTMRDQDLAIEADPLTLKETKTWS*
Ga0164299_1066635423300012958SoilMNPDNQQAPRSVRSSLAYGNTTRDPDWAIDEDPLTLKETKRWS*
Ga0182035_1084461613300016341SoilTSGQFGRSSLAYGSTTRDLDGAMQPDPLTLKETKTWS
Ga0187823_1012963823300017993Freshwater SedimentMNPDDEQAAGSVRSSLAYGNTMRDQDRAIDADPLTL
Ga0187770_1143539123300018090Tropical PeatlandMTLTMNKRPVSVRSSPAYGNTTRDRYTAIDDDPPTVKETKTWS
Ga0193701_100696233300019875SoilMNPDNQQAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS
Ga0193722_112298223300019877SoilMNPDNQQAASSARSSLAYGNTTRDQDWAMRPDPLTLKETKTWS
Ga0193725_114309723300019883SoilQAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS
Ga0193747_112129023300019885SoilMNPDNQQAASSARSSLAYGNTTRDQDWAIEADPQTLKETKTWS
Ga0193729_108392323300019887SoilMNPDNKQAASSVRSSLAYGNTTRDPDWAIDEDPLTLKETKTWS
Ga0193728_114776613300019890SoilPYPPCAGSMNPDNEQAASSVRSSLAYGNTKRDQDWASEADPLTVKETKTWS
Ga0193728_119107923300019890SoilMNPDNEQAASSVRSSLAYGNTKRDQDWASEADPLTVKETKTW
Ga0197907_1001643223300020069Corn, Switchgrass And Miscanthus RhizosphereMNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS
Ga0206354_1091546323300020081Corn, Switchgrass And Miscanthus RhizosphereMNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS
Ga0210407_1006611723300020579SoilMNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS
Ga0210399_1017029313300020581SoilMNPDNKQAASSVRSSLAYGNTTRDPDWAIDEDPLTLKETKRWS
Ga0210408_1003982823300021178SoilMNPDNQQAASSVRLSLAYVNTMRDPDWAIEADPLMLKETKTWS
Ga0210384_1021807323300021432SoilMNPDNQQAASSVRSSLAYVNTMRDPDWAIEADPLMLKETKTWS
Ga0210392_1010888623300021475SoilMNPDNQQAASSVRSSLAYGNTMRDQDMAIEANPLTLKETKTWS
Ga0126371_1029333123300021560Tropical Forest SoilMNPDNEQAASSVRSSLAYGSTTRDQDGANEADPLTVKETKTWS
Ga0224712_1030727123300022467Corn, Switchgrass And Miscanthus RhizosphereMNPDDEQAAGSVRSSLAYGNTVRDQDRAIEAIPLTVL
Ga0242657_124485913300022722SoilMNPDNQQAASSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS
Ga0207684_1096264023300025910Corn, Switchgrass And Miscanthus RhizosphereMNPDNQQAASSVRSSLAYGNTMRDQDWAIEADPLMLKETKTWS
Ga0207700_1041376813300025928Corn, Switchgrass And Miscanthus RhizosphereMNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDPLTLNGDENVEL
Ga0257159_106384413300026494SoilSCAGLMNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS
Ga0209156_1030003723300026547SoilWADEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS
Ga0209577_1065085713300026552SoilAVPSCTGLMNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS
Ga0207946_10653823300027108Forest SoilAVPSCAGQMNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS
Ga0208368_10927023300027161Forest SoilDGAAGITLKPYPPVLGLMSPDNQQAAGSVRSSLAYGSTTRDQDWAIEADPLT
Ga0209588_125449513300027671Vadose Zone SoilQAASSVRSSLAYGNTRRDQDWASEADPLTVKETKTWS
Ga0209177_1004711813300027775Agricultural SoilAASSVRSSLAYGNTTRDLDWAMRPDPLTLNGDETWS
Ga0307299_1001265233300028793SoilAASSVRSSLAYGNTTREQDRAMRPDPLTLKETKTWS
Ga0307286_1015810423300028876SoilCAVLMNPDNQQAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS
Ga0222749_1025365423300029636SoilMDPDNQQAASSVRSSLAYVNTMRDPDWAIEADPLMLKETKTWS
Ga0075382_1171049723300030917SoilPDNQQAASLVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS
Ga0265773_100578423300031018SoilAAGSVRSSLAYGNTMRDQDGGRQQDPLTVKETKTWS
Ga0308188_102889123300031097SoilNPDNQQAASSARSSLAYGNTTRDQDWAIEADPQTLKETKTWS
Ga0170822_1657822413300031122Forest SoilPSCAGLMNPDNQQAASSVRSSLAYGNTMRDQDMAIEANPLTLKETKTWS
Ga0307499_1003201423300031184SoilMNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDPLTLKETKNVEL
Ga0170819_1043209423300031469Forest SoilAGLMNPDNQQAASSVRSSLAYGNTMRDQDMAIEANPLTLKETKTWS
Ga0318516_1024865613300031543SoilCAGLMALNNELAAGSVRSSLAYGNTRRDQDRAKRPDPLTVKETKTWS
Ga0318571_1008993923300031549SoilMNPDNQQTASSVRSCPVYGSTTRDQDAAIEADPLTVKETKTWS
Ga0318574_1024578113300031680SoilMNPDNEQAASSGCSSLAYSNATRDRDGAIEADPLTVKETKTW
Ga0318500_1074384313300031724SoilMNPDNEQAASSGCSSLAYSNATRDRDGAIEADPLTVKETK
Ga0318565_1028685823300031799SoilAGSMNPDNEQAASSVRSSLAYGSTTRDQDGANEADPLTVKETKTWS
Ga0307473_1030130623300031820Hardwood Forest SoilMNPDNQQAASSVRSSLAYGNTMRDPDMAIEADPLTLKETKTWS
Ga0306926_1038382813300031954SoilASSVRSSLAYGSTKRDQDGANEADPLTVKETKTWS
Ga0318559_1013950823300032039SoilAGSMNPDNQQTASSVRSCPVYGSTTRDQDAAIEADPLTVKETKTWS
Ga0307471_10063122223300032180Hardwood Forest SoilMSPDNQQAAGSVRSSLAYGSTTRDQDWAIEADPLT
Ga0335085_1020845023300032770SoilMNPDNEQAASSVRSSLAYSNATRDQDGAIEADPLTVKETKTWS
Ga0335082_1010510233300032782SoilMNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLMMKETKTWS
Ga0335078_1199717823300032805SoilMNPDNQQTASSVRSCLAYGSTTRDQDAAIKADPLTV
Ga0335070_1074003923300032829SoilMNPDNQQAASSVRSSLAYSSATREQDGAIEADPLTVKETKTWS
Ga0335072_1143814813300032898SoilMNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLTMKETKTWS
Ga0310811_1023968533300033475SoilNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.