NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099532

Metagenome Family F099532

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099532
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 147 residues
Representative Sequence MAPVSLVLGRQGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLANGKAYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR
Number of Associated Samples 94
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.71 %
% of genes near scaffold ends (potentially truncated) 89.32 %
% of genes from short scaffolds (< 2000 bps) 89.32 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.029 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(17.476 % of family members)
Environment Ontology (ENVO) Unclassified
(25.243 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.660 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 45.93%    Coil/Unstructured: 54.07%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF14595Thioredoxin_9 29.13
PF04909Amidohydro_2 8.74
PF00528BPD_transp_1 2.91
PF14716HHH_8 0.97
PF00400WD40 0.97
PF07727RVT_2 0.97
PF02470MlaD 0.97



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000443|F12B_10062356All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300002561|JGI25384J37096_10246969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium520Open in IMG/M
3300002562|JGI25382J37095_10022684All Organisms → cellular organisms → Bacteria2443Open in IMG/M
3300004281|Ga0066397_10177711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces ipomoeae503Open in IMG/M
3300005171|Ga0066677_10097687All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1550Open in IMG/M
3300005174|Ga0066680_10071816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales2074Open in IMG/M
3300005179|Ga0066684_10251080All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1161Open in IMG/M
3300005180|Ga0066685_10174233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1470Open in IMG/M
3300005332|Ga0066388_100520747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1822Open in IMG/M
3300005332|Ga0066388_108508749All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium511Open in IMG/M
3300005353|Ga0070669_101713381All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium548Open in IMG/M
3300005447|Ga0066689_10108307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales1604Open in IMG/M
3300005526|Ga0073909_10510452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces turgidiscabies583Open in IMG/M
3300005540|Ga0066697_10028236All Organisms → cellular organisms → Bacteria3095Open in IMG/M
3300005554|Ga0066661_10245681All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1108Open in IMG/M
3300005555|Ga0066692_10171051All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1345Open in IMG/M
3300005568|Ga0066703_10062416All Organisms → cellular organisms → Bacteria2117Open in IMG/M
3300005576|Ga0066708_10031278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2842Open in IMG/M
3300005843|Ga0068860_102711317All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300006194|Ga0075427_10056203All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium684Open in IMG/M
3300006797|Ga0066659_10196901All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1472Open in IMG/M
3300006844|Ga0075428_102051434All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300006845|Ga0075421_102690079All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300006847|Ga0075431_100964681All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium820Open in IMG/M
3300006854|Ga0075425_101576495All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium740Open in IMG/M
3300006854|Ga0075425_102297512All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium599Open in IMG/M
3300006871|Ga0075434_101251752All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium753Open in IMG/M
3300006881|Ga0068865_101574467All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium590Open in IMG/M
3300006904|Ga0075424_102437866All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium548Open in IMG/M
3300007076|Ga0075435_100499492All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1052Open in IMG/M
3300007076|Ga0075435_101262962All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium646Open in IMG/M
3300007255|Ga0099791_10323764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium736Open in IMG/M
3300009012|Ga0066710_100002270All Organisms → cellular organisms → Bacteria15347Open in IMG/M
3300009100|Ga0075418_10945558All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium932Open in IMG/M
3300009100|Ga0075418_12348397All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium582Open in IMG/M
3300009176|Ga0105242_13005283All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300009804|Ga0105063_1066690All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium548Open in IMG/M
3300010043|Ga0126380_11847664All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium548Open in IMG/M
3300010303|Ga0134082_10226430All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium770Open in IMG/M
3300010321|Ga0134067_10239343All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium680Open in IMG/M
3300010335|Ga0134063_10654597All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300010360|Ga0126372_12111305All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium611Open in IMG/M
3300010362|Ga0126377_10977608All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium912Open in IMG/M
3300010398|Ga0126383_10579906All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1190Open in IMG/M
3300010400|Ga0134122_11305555All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium734Open in IMG/M
3300010401|Ga0134121_10253064All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1542Open in IMG/M
3300012207|Ga0137381_10707425All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium876Open in IMG/M
3300012917|Ga0137395_10309394All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1120Open in IMG/M
3300012922|Ga0137394_10930527All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium725Open in IMG/M
3300012923|Ga0137359_10061351All Organisms → cellular organisms → Bacteria → Proteobacteria3277Open in IMG/M
3300012976|Ga0134076_10085533All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1235Open in IMG/M
3300015372|Ga0132256_101998644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium686Open in IMG/M
3300015373|Ga0132257_100580309All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1383Open in IMG/M
3300015374|Ga0132255_104778053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium574Open in IMG/M
3300016341|Ga0182035_10296393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1324Open in IMG/M
3300016387|Ga0182040_11479005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium576Open in IMG/M
3300025899|Ga0207642_10141455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1269Open in IMG/M
3300025937|Ga0207669_11902790All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300026088|Ga0207641_10325706All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1458Open in IMG/M
3300026296|Ga0209235_1089393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1353Open in IMG/M
3300026315|Ga0209686_1191250All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium561Open in IMG/M
3300026324|Ga0209470_1148707All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1029Open in IMG/M
3300026325|Ga0209152_10068867All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1277Open in IMG/M
3300026328|Ga0209802_1086936All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1437Open in IMG/M
3300026334|Ga0209377_1091196All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1280Open in IMG/M
3300026335|Ga0209804_1032087All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2657Open in IMG/M
3300026342|Ga0209057_1023139All Organisms → cellular organisms → Bacteria3447Open in IMG/M
3300026377|Ga0257171_1097981All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium520Open in IMG/M
3300026523|Ga0209808_1159934All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium845Open in IMG/M
3300026540|Ga0209376_1162627All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1057Open in IMG/M
3300027013|Ga0209884_1040047All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300027527|Ga0209684_1032626All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium796Open in IMG/M
3300027821|Ga0209811_10080511All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1150Open in IMG/M
3300027873|Ga0209814_10259718All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium754Open in IMG/M
3300028792|Ga0307504_10396467All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium542Open in IMG/M
3300031546|Ga0318538_10198489All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1071Open in IMG/M
3300031547|Ga0310887_10109588All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1384Open in IMG/M
3300031680|Ga0318574_10014065All Organisms → cellular organisms → Bacteria3741Open in IMG/M
3300031681|Ga0318572_10021369All Organisms → cellular organisms → Bacteria3254Open in IMG/M
3300031740|Ga0307468_100636658All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium878Open in IMG/M
3300031740|Ga0307468_101294174All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium663Open in IMG/M
3300031740|Ga0307468_101401536All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300031740|Ga0307468_101817979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium577Open in IMG/M
3300031740|Ga0307468_102295979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium524Open in IMG/M
3300031744|Ga0306918_10155596All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1692Open in IMG/M
3300031780|Ga0318508_1152911All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium655Open in IMG/M
3300031794|Ga0318503_10299602All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300031820|Ga0307473_10060261All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1850Open in IMG/M
3300031846|Ga0318512_10638380All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300031880|Ga0318544_10277842All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium649Open in IMG/M
3300031892|Ga0310893_10128535All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium962Open in IMG/M
3300031897|Ga0318520_10150689All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1348Open in IMG/M
3300031944|Ga0310884_10208140All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1048Open in IMG/M
3300031959|Ga0318530_10114712All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1079Open in IMG/M
3300032012|Ga0310902_11143192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium546Open in IMG/M
3300032043|Ga0318556_10258146All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium910Open in IMG/M
3300032068|Ga0318553_10222243All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium985Open in IMG/M
3300032075|Ga0310890_10521045All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium907Open in IMG/M
3300032180|Ga0307471_103439123All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium560Open in IMG/M
3300032205|Ga0307472_100941940All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium803Open in IMG/M
3300032205|Ga0307472_102533889All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300033412|Ga0310810_10859144All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium806Open in IMG/M
3300034817|Ga0373948_0141672All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium595Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.94%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027013Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F12B_1006235623300000443SoilLEQMAPVSLVLGRQGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSHDGAWLFTPXXXXXXXXXXXXXXXXAYPVFTGAGPFYKAMSISVPASLVALLHPGDAQGRGPYGLEVWRLTYRTR*
JGI25384J37096_1024696913300002561Grasslands SoilRWRPSRSPWGARGRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP*
JGI25382J37095_1002268413300002562Grasslands SoilQGTRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP*
Ga0066397_1017771113300004281Tropical Forest SoilNVYAAAFASDGQTLATASDQGNIKLWAWPGLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQREERIFDNTPQAPGHGMHGEMRRSLAFSLDGDWIFAPDMHDRGVRILNAANGKAFPVFTGDAPFYKAMSISVPASLVALLRPGDEQGRGP
Ga0066677_1009768713300005171SoilQGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGHGPYGLEVWRLTYRTK*
Ga0066680_1007181633300005174SoilDGQVLATVSDQGSLKLWSWPALSLRASVSMSKSLEPMAPVSLALGRQGTRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP*
Ga0066684_1025108013300005179SoilWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDLAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYEAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP*
Ga0066685_1017423323300005180SoilVTVSDQGSLKVWAWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDLAKEREERIFDYTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP*
Ga0066388_10052074713300005332Tropical Forest SoilGRVHIVDLAKQREERTFDNTPQAPGHGMHGEMRRSLAFSQDGDWIFAPDLHDRGVRILNAASGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYGLEVWRLTYSTR*
Ga0066388_10850874913300005332Tropical Forest SoilNSILGRVHVVDTGRAREERSFANAAEAPGHGMHAEMRRSLEFSQDGGWLFAPDMHDRGVRILDLANGKAYPVLTGTAPFYKAMSISVPASLVALLRPGDTEGRGPYGLEVWRLSYRGR*
Ga0070669_10171338113300005353Switchgrass RhizosphereLATASDQGVMKVWAWPALTLRASVSMSKSLEQMAPVSLVLGGHGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGTAYPVFTGAGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLIYRGR*
Ga0066689_1010830713300005447SoilVSLVLQGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDGQGRGPYGLEVWRLAYRTR*
Ga0073909_1051045213300005526Surface SoilAFSSDGQVLATASDQGVMKVWAWPALTLRASVSMSKSLEQMAPVSLVLGRHGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLANGKAYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR*
Ga0066697_1002823633300005540SoilVTVSDQGSLKVWTWPALTLRTSLTMSKSLDAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP*
Ga0066661_1024568123300005554SoilVTVSDQGSLKVWTWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP*
Ga0066692_1017105133300005555SoilLWSWPALSLRASVSMSKSLEPMAPVSLALGRQGTRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP*
Ga0066703_1006241623300005568SoilVTVSDQGSLKVWTWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRANPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPNGLEVWRVTYRKP*
Ga0066708_1003127833300005576SoilVTVSDQGSLKVWTWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYEAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP*
Ga0068860_10271131723300005843Switchgrass RhizosphereEAMAPVSLVLGRQGTRAAANGLLGRVHVVDLVKEREEQTFNNTPEAPGHGMHAEMRGSLAFSQDGDWLFAPDMHDRGVRILHVPSGKAYPVLRGGGPFYKAMSISIPASLVALLRPGDDQGRGPYGLEIWRLMYRAS*
Ga0075427_1005620323300006194Populus RhizosphereRVSPGHAHSLSAPSCDAVTRSRPSEENAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGNSYPVFRGQAPFYKAMSISVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR*
Ga0066659_1019690123300006797SoilVTVSDQGSLKVWTWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDLAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP*
Ga0075428_10205143423300006844Populus RhizosphereGRVHIVDLAKEREERTFDSTAQAPGHGLHGEMRWSLAFSHDGEWLFAPDMHDGGVRILHLASGKTYPVLRGEVPFYKAMSISVPASLVALLHPGDHQGRGPYGLEVWRLSYR*
Ga0075421_10269007913300006845Populus RhizosphereRGSVAMSKSLEAMAPVSLVIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGKSYPVFRGQAPFYKAMSVSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR*
Ga0075431_10096468113300006847Populus RhizospherePGLALRGSVAMSKSLEAMAPVSLVIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGKSYPVFRGQAPFYKAMSVSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR*
Ga0075425_10157649513300006854Populus RhizosphereSDQGVIKVWAWPALTLRASVSMSKSLEQMAPVSLVLGRQGTRAAANGLLGRVHIVDLAKEREERIVDNTPEAPGHGMHGEMRRSLEFSQDGGWLFAPDMHDRGVRVLDLANGKTYPVFTGAAPFYKAMSISVPASLVALLRPGDVQGRGPYGLEVWRLSYRGR*
Ga0075425_10229751223300006854Populus RhizosphereSDQGVIKVWAWPALTLRASVSMSKSLEQMAPVSLVLGRQGALAAANGLLGKVHIVDLAKEREARTFDNTPEAPGHGMHAEMRRSLEFSQDGGWLFAPDMHDRGVRILDLANGTTYPVFTGAAPFYKAMSISVPASLVALLRPGDVQGRGPYGLEVWRLSYRGR*
Ga0075434_10125175223300006871Populus RhizosphereDQGVIKVWAWPALTLRASVSMSKSLEQMAPVSLVLGRQGTRAAANGLLGRVHIVDLAKEREERIVDNTPEAPGHGMHGEMRRSLEFSQDGGWLFAPDMHDRGVRVLDLANGKTYPVFTGAAPFYKAMSISVPASLVALLRPGDVQGRGPYGLEVWRLSYRGR*
Ga0068865_10157446713300006881Miscanthus RhizosphereGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGTAYPVFTGAGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLIYRGR*
Ga0075424_10243786613300006904Populus RhizosphereSDQGVIKVWAWPALTLRASVSMSKSLEQMAPVSLVLGRQGALAAANGLLGKVHIVDLAKEREARTFDNTPEAPGHGMHAEMRRSLEFSQDGGWLFAPDMHDRGVRILDLANGKTYPVFTGAAPFYKAMSISVPASLVALLRPGDTEGRGPYGLEVWRLSYRGR*
Ga0075435_10049949223300007076Populus RhizosphereQGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDGQGRGPYGLEVWRLTYRTR*
Ga0075435_10126296213300007076Populus RhizosphereVYAAAFSSDGRILATASDQGVIKVWTWPALTMRASVSMSKSLEPMAPVSLVLARQGTRAAANGLLGRVHIVDLAKEREERIVDNTPEAPGHGMHAEMRRSLEFSQDGGWLFAPDMHDRGVRILDLANGTTYPVFTGAAPFYKAMSISVPASLVALLRPGDVQGRGPYGLEVWRLSYRGR*
Ga0099791_1032376413300007255Vadose Zone SoilIEAMAPVSLALGRQGTRAAANGLLGRVHIVDLVKEREERTFDNTAEAPGHGMHAEMRGSLAFSQDGDWLFAPDMHDRGVRILHVASGKAYPIFRGEAPFYKAMSISVPASLVALLRPGDHQGRGPYGVEVWRLTYR*
Ga0066710_10000227013300009012Grasslands SoilGVYGVAFSSAGQVLATVSDQGSLKLWSWPALSLRASVSMSKSLEPMAPVSLALGRQGTRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP
Ga0075418_1094555823300009100Populus RhizosphereAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGNSYPVFRGQAPFYKAMSISVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR
Ga0075418_1234839723300009100Populus RhizosphereSVATSKSLEAMAPVSLVLGRQGTRAAANSLHGRVHIVDFAKEREERTFDSTAQAPGHGLHGEMRWSLAFSHDGEWLFAPDMHDSGVRILHLASGKTYPVLRGEVPFYKAMSISVPASLVALLHPGDHQGRGPYGLEVWRLSYR*
Ga0105242_1300528323300009176Miscanthus RhizosphereLLGRVHVVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILHLASGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRLAYRTR*
Ga0105063_106669013300009804Groundwater SandLALTRRGTRAAANGIVGQVHVVDAAREREERTFANTVEAPGHAPRAEMRRSLAFSEDGDWLFAPDSHDRGLRILNVSSGKTHTVLRGDGPFYKAMAITVPASLVAFLRPGDGQGRGPYGLEVWRLTYRAR*
Ga0126380_1184766423300010043Tropical Forest SoilLVVGRQGTRAAANGLLGRVHIVDLAKRQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGNWLFAPDMHDRGVRILDLASGKAYPVFTGDAPFYKAMSVSVPASLVALLRPGDAQGRGPYGLEVWRLTYRTP*
Ga0134082_1022643023300010303Grasslands SoilVWTWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRLTYRTK*
Ga0134067_1023934323300010321Grasslands SoilMAPVSLTLGRQGTRAAANGLLGRVHVVDLAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGP
Ga0134063_1065459713300010335Grasslands SoilQGSLKVWTWPALTLRTSLTMSKSLEAMAPVSLTLGRQDTRAAANGLLGRVHVVDLAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYEAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP*
Ga0126372_1211130513300010360Tropical Forest SoilANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPASLVALLRPGDEQGRGPYGLEVWRLTYSTR*
Ga0126377_1097760813300010362Tropical Forest SoilAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQREERTFDNTPQAPGHGMHGEMRRSLAFSQDGDWLFAPDMHDRGVRILNAANGKAYPVITGDAPFYKAMSISVPASLVALLRPGDEQGRGPYGLEVWRLIYSTR*
Ga0126383_1057990623300010398Tropical Forest SoilRSLEQMAPVSLVIGRQGTRAAANGLLGRVHVVDLAKQREERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPGMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPASLVALLRPGDEQGRGPYGLEVWRLTYSTR*
Ga0134122_1130555513300010400Terrestrial SoilQLLATVSDQGALKVWSWPALALRTSVTMSKSLEAMAPVSLALGRQGTRAAANGLLGRVHVVDLAKAREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILHLASGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRLTYRTR*
Ga0134121_1025306413300010401Terrestrial SoilQGVIKVWAWPALTLRASVSMSKSLEQMAPVSLVLGRQGALAAANGLLGRVHIVDLAKEREARTFDNTPEAPGHGMHAEMRRSLEFSQDGGWLFAPDMHDRGVRILDLANGKTYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR*
Ga0137381_1070742513300012207Vadose Zone SoilSIKVWTWPALTLRTSVSMSKSLEQIAPVSLVLGRQGTRAAVNGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGKAYPVFTGTGPFYKAMSISVPTSLVALLRPGDAQGRGPYGLEVWRLTYRGR*
Ga0137395_1030939423300012917Vadose Zone SoilAANGLLGRVHIVDLAKEREERTFDNAPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRIVDLASGKAYPVFTGTGPFYKAMSISVPTSLVALLRPGDAQGRGPYGLEVWRLTYRGR
Ga0137394_1093052723300012922Vadose Zone SoilLNRDGTRAASNGILGKVHVLDTVKGREERIFDNVAEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGKAYPVFTGTGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLTYRGG*
Ga0137359_1006135113300012923Vadose Zone SoilNAHGGEAIYGAVFSSDGQVLATVSDQGSIKAWTWPALTLRTSVSMSKSLEPMAPVSLVLGRQGMRAAANGLLGRVHVVDIAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDTHDRGVRILNLSSGKSYPIFRGDAPFYKAMSIAVSASLVALLRPGDDQGRGPYGLEVWRLTYRTR*
Ga0134076_1008553323300012976Grasslands SoilWTWPALTLRTSVSMSKSLEQMAPVSLVLGRQGTRAVANGLLGRVHVVDIAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRLAYRTR*
Ga0132256_10199864423300015372Arabidopsis RhizosphereLATASDQGVIKVWAWPAVTLRASVAMSKSLEQMAPVSLVLGRYGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGLHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGKAYPVFTGAGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR*
Ga0132257_10058030913300015373Arabidopsis RhizosphereSLEQMAPVSLVLGRQGTRAASNGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFTPDMHDRGVRILDLANGKAYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR*
Ga0132255_10477805313300015374Arabidopsis RhizosphereGTRAASNGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLANGKAYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR*
Ga0182035_1029639333300016341SoilVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0182040_1147900513300016387SoilLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0207642_1014145513300025899Miscanthus RhizosphereMSKSLEQMAPVSLVLGGHGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGTAYPVFTGAGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLIYRGR
Ga0207669_1190279013300025937Miscanthus RhizosphereGVMKVWAWPALTLRASVSMSKSLEQMAPVSLVLGGHGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGTAYPVFTGAGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLIYRGR
Ga0207641_1032570623300026088Switchgrass RhizosphereENVYATAFSSDGRILATASDQGVIKVWAWPALTLRASVSMSKSLEQMAPVSLVLGRQGALAAANGLLGRVHIVDLAKEREARTFDNTPEAPGHGMHAEMRRPLEFSQDGGWLFAPDMHDRGVRILDLANGKTYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRG
Ga0209235_108939313300026296Grasslands SoilGQVLATVSDQGSLKLWSWPALSLRASVSMSKSLEPMAPVSLALGRQGTRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP
Ga0209686_119125013300026315SoilQGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGHGPYGLEVWRLTYRTK
Ga0209470_114870713300026324SoilSMSKSLEPMAPVSLALGRQGTRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP
Ga0209152_1006886733300026325SoilNGLLGRVHVVDIAKDREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDGQGRGPYGLEVWRLAYRTR
Ga0209802_108693613300026328SoilLKLWSWPALSLRASVSMSKSLEPMAPVSLALGRQGTRAAANGILGTVHIVDVAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP
Ga0209377_109119633300026334SoilSMSKSLEPMAPVSLALGRQGTRAAANGILGTVHIVDPAKEREERTFANTPEAPGHGMHAEMRRSLAFTQDGAWLFAPDLHDRGLRILHVASGKAYPVFRGDGPFYKAMSIAVPASMVALLRPGDDQGRGPYGLEVWRLTYRAP
Ga0209804_103208733300026335SoilVTVSDQGSLKVWTWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPNGLEVWRVTYRKP
Ga0209057_102313933300026342SoilVTVSDQGSLKVWTWPALTLRTSLTMSKSLDAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP
Ga0257171_109798113300026377SoilLKVWVWPALTLRTSVETSKSLEAMAPVSLVLGRQGARAAANSLHGRVHIVDLAKQREERTFDNTPQAPGHGLHGEMRRSVAFTHDGDWLFAPDTHDRGVRILNLGSGKTYPVFRGDVPFYKAMSISIPAGLVALLHPGDDQGRGPYGLEVWRLTYR
Ga0209808_115993413300026523SoilVWAWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDFAKEREERIFDNTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYEAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP
Ga0209376_116262723300026540SoilAIFSQARSLPSRQGRSCVVTVSDQGSLKVWAWPALTLRTSLTMSKSLEAMAPVSLTLGRQGTRAAANGLLGRVHVVDLAKEREERIFDYTPEAPGHGMHAEMRRSLAFSQDGEWLFAPDMHDRGVRILHVASGRAYPVFQGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRVTYRKP
Ga0209884_104004713300027013Groundwater SandVLATVSDQGSLKLWDWPALTLRASVPMSKSLEPMAPVSLALTRRGTRAAANGIVGQVHVVDAAREREERTFANTVEAPGHAPRAEMRRSLAFSEDGDWLFAPDSHDRGLRILNVSSGKTHTVLRGDGPFYKAMAITVPASLVAFLRPGDGQGRGPYGLEVWRLTYRAR
Ga0209684_103262623300027527Tropical Forest SoilRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0209811_1008051113300027821Surface SoilGALKVWSWPALTLRTSVTMSKSLEAMAPVSLVLGRQGTRAAANGLLGRVHVVDLGKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILDLANGKAYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR
Ga0209814_1025971823300027873Populus RhizosphereIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDCGVRILHLGSGKSYPVFRGQAPFYKAMSVSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR
Ga0307504_1039646723300028792SoilKSLEQMAPVSLVLGRYGTRAAANGLLGRVHIVDLAKDREERTFDNTPEAPGHGMHAEMRRSLAFSQDGNWLFAPDVYDRGLRILDLTSGRTYPVFRGDTPYYTAMSISVPASLVAVIRPSDVPARGPYGLEVWRLTYRTP
Ga0318538_1019848913300031546SoilLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTDSTR
Ga0310887_1010958813300031547SoilMSKSLEAMAPVSLVIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGKSYPVFRGQAPFYKAMSMSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR
Ga0318574_1001406563300031680SoilLTQRARGENVCAAAFSSDGQALVTASDQGNIGVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQRRGPYALEVWRLTYSTR
Ga0318572_1002136953300031681SoilSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0307468_10063665823300031740Hardwood Forest SoilVTASHEGALKGWAWPGLTLRASVATSKSLEAMAPVSLVLGGRQGTLAAANSLHGRVHIVDLAKEREERTFDSTAQAPGHGLHGEMRRSVAFTNDGDWLFAPDMHDSGVRILHLASGKTYPVFRGDVPFYKAMSISVPASLVALLHPGDNQGRGPYGLEVWRLTYR
Ga0307468_10129417423300031740Hardwood Forest SoilVSLVLGRHGTRAAANGLLGQVHIVDLAKEREERTFDNTSEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGKAYPVFTGAGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLTYRGR
Ga0307468_10140153623300031740Hardwood Forest SoilILATASDQGSIKVWAWPALTLRSSVSMSKSLEQMAPVSLVLGRQGTRAAANGLAGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLANGKTYPVFTGDAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEIWRLTYRTP
Ga0307468_10181797913300031740Hardwood Forest SoilSKSLEAMAPVSLVIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGKSYPVFRGQAPFYKAMSMSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR
Ga0307468_10229597923300031740Hardwood Forest SoilTSVETSKSLEAMAPVSLVLGRQGARAAANSLHGRVHIVDLAKQREERTFDNTPQAPGHGLHGEMRRSVAFTHDGHWLFAPDTHDRGVRILNLGSGKTYPVFRGDVPFYKAMSISIPAGLVALLHPGDDQGRGPYGLEVWRLTYR
Ga0306918_1015559613300031744SoilLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0318508_115291123300031780SoilIKVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0318503_1029960213300031794SoilDQGNIGVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0307473_1006026133300031820Hardwood Forest SoilVSLVLGRQGTRAVANGLLGRVHVVDIAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDMHDRGVRILNLSSGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRLTYRTK
Ga0318512_1063838013300031846SoilSDQGNIGVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0318544_1027784223300031880SoilIGVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0310893_1012853513300031892SoilPGLTLRGSVAMSKSLEAMAPVSLVIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGKSYPVFRGQAPFYKAMSMSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR
Ga0318520_1015068923300031897SoilSDQGNIKVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0310884_1020814013300031944SoilGLTLRGSVAMSKSLEAMAPVSLVIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGKSYPVFRGQAPFYKAMSMSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR
Ga0318530_1011471223300031959SoilLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLLALLRPGDEQGRGPYALEVWRLTYSTR
Ga0310902_1114319223300032012SoilAASNGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLANGKAYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRG
Ga0318556_1025814623300032043SoilVCAAAFSSDGQALVTASDQGNIGVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0318553_1022224313300032068SoilNIKVWAWPTLTLRASVSMSKSLEQMAPVSLVIGRQGTRAAANGLLGRVHIVDLAKQQEERIFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPAMHDRGVRILNLANGKAYPVFTGDAPFYKAMSISVPSSLVALLRPGDEQGRGPYALEVWRLTYSTR
Ga0310890_1052104513300032075SoilGSVAMSKSLEAMAPVSLVIGRQGALAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRSSLAFSHDGEWLFAPDMHDGGVRILHLGSGKSYPVFRGQAPFYKAMSMSVPSSLVALLRPGDVQGRGPYGLEVWRLTYATR
Ga0307471_10343912313300032180Hardwood Forest SoilANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLANGKAYPVFTGTGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLTYRTR
Ga0307472_10094194013300032205Hardwood Forest SoilRQGTRAAANGLLGRVHIVDLAKEREERTSDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLASGKAYPVFTGAGPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLTYRGR
Ga0307472_10253388913300032205Hardwood Forest SoilGTLAAANSLHGRVHIVDLAKEREERTFDSTAQAPGHGLHGEMRRSVAFTNDGDWLFAPDMHDSGVRILHLASGKTYPVFRGDVPFYKAMSISVPASLVALLHPGDNQGRGPYGLEVWRLTYR
Ga0310810_1085914423300033412SoilTRAAANGLLGRVHVVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGDWLFAPDTHDRGVRILHLASGKTYPVFRGDAPFYKAMSISVPASLVALLRPGDDQGRGPYGLEVWRLTYRTR
Ga0373948_0141672_180_5873300034817Rhizosphere SoilMAPVSLVLGRQGTRAAANGLLGRVHIVDLAKEREERTFDNTPEAPGHGMHAEMRRSLAFSQDGAWLFAPDMHDRGVRILDLANGKAYPVFTGAAPFYKAMSISVPASLVALLRPGDAQGRGPYGLEVWRLSYRGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.