Basic Information | |
---|---|
Family ID | F099293 |
Family Type | Metagenome |
Number of Sequences | 103 |
Average Sequence Length | 46 residues |
Representative Sequence | MLDYKQRLDSIMLQLQEIIDEEYEDNDYVQTAFNNLAIILDDNPV |
Number of Associated Samples | 64 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 83.33 % |
% of genes near scaffold ends (potentially truncated) | 18.45 % |
% of genes from short scaffolds (< 2000 bps) | 77.67 % |
Associated GOLD sequencing projects | 56 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.903 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (17.476 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.864 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.427 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF01541 | GIY-YIG | 2.91 |
PF00004 | AAA | 0.97 |
PF00565 | SNase | 0.97 |
PF04983 | RNA_pol_Rpb1_3 | 0.97 |
PF00768 | Peptidase_S11 | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG0086 | DNA-directed RNA polymerase, beta' subunit/160 kD subunit | Transcription [K] | 0.97 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.90 % |
All Organisms | root | All Organisms | 30.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002835|B570J40625_100734675 | Not Available | 878 | Open in IMG/M |
3300004112|Ga0065166_10133174 | Not Available | 935 | Open in IMG/M |
3300005582|Ga0049080_10008825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3496 | Open in IMG/M |
3300005662|Ga0078894_10071559 | Not Available | 2996 | Open in IMG/M |
3300005662|Ga0078894_10127898 | Not Available | 2266 | Open in IMG/M |
3300005662|Ga0078894_10162465 | Not Available | 2012 | Open in IMG/M |
3300005662|Ga0078894_10166177 | All Organisms → Viruses → Predicted Viral | 1989 | Open in IMG/M |
3300005662|Ga0078894_10250694 | Not Available | 1605 | Open in IMG/M |
3300005662|Ga0078894_10297997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1462 | Open in IMG/M |
3300005662|Ga0078894_10462760 | Not Available | 1141 | Open in IMG/M |
3300005662|Ga0078894_10898355 | Not Available | 768 | Open in IMG/M |
3300005662|Ga0078894_11027467 | Not Available | 708 | Open in IMG/M |
3300005662|Ga0078894_11342444 | Not Available | 600 | Open in IMG/M |
3300005941|Ga0070743_10111132 | Not Available | 919 | Open in IMG/M |
3300006484|Ga0070744_10039164 | Not Available | 1397 | Open in IMG/M |
3300006484|Ga0070744_10056382 | Not Available | 1148 | Open in IMG/M |
3300006484|Ga0070744_10060060 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
3300006484|Ga0070744_10157397 | Not Available | 651 | Open in IMG/M |
3300006484|Ga0070744_10205126 | Not Available | 560 | Open in IMG/M |
3300006484|Ga0070744_10214475 | Not Available | 546 | Open in IMG/M |
3300006641|Ga0075471_10379824 | Not Available | 711 | Open in IMG/M |
3300006641|Ga0075471_10546074 | Not Available | 572 | Open in IMG/M |
3300006875|Ga0075473_10136904 | Not Available | 981 | Open in IMG/M |
3300007559|Ga0102828_1031947 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
3300007559|Ga0102828_1035515 | Not Available | 1130 | Open in IMG/M |
3300007560|Ga0102913_1056713 | Not Available | 1277 | Open in IMG/M |
3300007562|Ga0102915_1236212 | Not Available | 592 | Open in IMG/M |
3300007590|Ga0102917_1249192 | Not Available | 616 | Open in IMG/M |
3300007606|Ga0102923_1106577 | Not Available | 879 | Open in IMG/M |
3300007644|Ga0102902_1225711 | Not Available | 551 | Open in IMG/M |
3300007653|Ga0102868_1120362 | Not Available | 610 | Open in IMG/M |
3300007667|Ga0102910_1128033 | Not Available | 594 | Open in IMG/M |
3300008950|Ga0102891_1235845 | Not Available | 526 | Open in IMG/M |
3300009024|Ga0102811_1360576 | Not Available | 548 | Open in IMG/M |
3300009026|Ga0102829_1323756 | Not Available | 516 | Open in IMG/M |
3300009059|Ga0102830_1192553 | Not Available | 597 | Open in IMG/M |
3300009159|Ga0114978_10030308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3873 | Open in IMG/M |
3300009161|Ga0114966_10366280 | Not Available | 852 | Open in IMG/M |
3300009164|Ga0114975_10020774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3985 | Open in IMG/M |
3300009419|Ga0114982_1011057 | All Organisms → Viruses → Predicted Viral | 3183 | Open in IMG/M |
3300009419|Ga0114982_1076138 | Not Available | 1043 | Open in IMG/M |
3300009419|Ga0114982_1117791 | Not Available | 820 | Open in IMG/M |
3300010160|Ga0114967_10020628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4620 | Open in IMG/M |
3300010160|Ga0114967_10477704 | Not Available | 612 | Open in IMG/M |
3300010354|Ga0129333_10135927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 2260 | Open in IMG/M |
3300012352|Ga0157138_1012589 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
3300012352|Ga0157138_1035323 | Not Available | 792 | Open in IMG/M |
3300012352|Ga0157138_1079537 | Not Available | 514 | Open in IMG/M |
3300012663|Ga0157203_1000144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25161 | Open in IMG/M |
3300012663|Ga0157203_1007592 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
3300012665|Ga0157210_1003944 | All Organisms → Viruses → Predicted Viral | 3271 | Open in IMG/M |
3300012665|Ga0157210_1009202 | All Organisms → Viruses → Predicted Viral | 1787 | Open in IMG/M |
3300012665|Ga0157210_1035937 | Not Available | 770 | Open in IMG/M |
3300013005|Ga0164292_10541499 | Not Available | 758 | Open in IMG/M |
3300020141|Ga0211732_1537394 | Not Available | 787 | Open in IMG/M |
3300020141|Ga0211732_1557836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1431 | Open in IMG/M |
3300020151|Ga0211736_10850256 | Not Available | 584 | Open in IMG/M |
3300020151|Ga0211736_10936927 | Not Available | 1645 | Open in IMG/M |
3300020151|Ga0211736_11033641 | Not Available | 711 | Open in IMG/M |
3300020159|Ga0211734_10154025 | Not Available | 535 | Open in IMG/M |
3300020159|Ga0211734_11104112 | Not Available | 1110 | Open in IMG/M |
3300020160|Ga0211733_10568818 | Not Available | 583 | Open in IMG/M |
3300020172|Ga0211729_10691238 | Not Available | 1194 | Open in IMG/M |
3300020205|Ga0211731_10506870 | Not Available | 863 | Open in IMG/M |
3300020480|Ga0208201_103836 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300021952|Ga0213921_1049708 | Not Available | 620 | Open in IMG/M |
3300021956|Ga0213922_1002555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6169 | Open in IMG/M |
3300021956|Ga0213922_1008251 | Not Available | 2991 | Open in IMG/M |
3300021956|Ga0213922_1011324 | All Organisms → Viruses → Predicted Viral | 2462 | Open in IMG/M |
3300021961|Ga0222714_10011662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7444 | Open in IMG/M |
3300021963|Ga0222712_10463572 | Not Available | 757 | Open in IMG/M |
3300021963|Ga0222712_10619494 | Not Available | 622 | Open in IMG/M |
3300021963|Ga0222712_10745168 | Not Available | 546 | Open in IMG/M |
3300022747|Ga0228703_1009852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3629 | Open in IMG/M |
3300024343|Ga0244777_10060593 | All Organisms → Viruses → Predicted Viral | 2426 | Open in IMG/M |
3300024343|Ga0244777_10572929 | Not Available | 687 | Open in IMG/M |
3300024346|Ga0244775_10090421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2609 | Open in IMG/M |
3300024346|Ga0244775_10270179 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
3300024346|Ga0244775_10372112 | Not Available | 1177 | Open in IMG/M |
3300024346|Ga0244775_11122856 | Not Available | 615 | Open in IMG/M |
3300024348|Ga0244776_10266758 | Not Available | 1184 | Open in IMG/M |
3300025872|Ga0208783_10231390 | Not Available | 754 | Open in IMG/M |
3300027193|Ga0208800_1061518 | Not Available | 512 | Open in IMG/M |
3300027286|Ga0255129_1052695 | Not Available | 627 | Open in IMG/M |
3300027292|Ga0255134_1018248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
3300027320|Ga0208923_1084619 | Not Available | 561 | Open in IMG/M |
3300027593|Ga0255118_1022421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300027631|Ga0208133_1053858 | Not Available | 970 | Open in IMG/M |
3300027631|Ga0208133_1115333 | Not Available | 625 | Open in IMG/M |
3300027710|Ga0209599_10020031 | Not Available | 1893 | Open in IMG/M |
3300027710|Ga0209599_10087057 | Not Available | 820 | Open in IMG/M |
3300027732|Ga0209442_1153003 | Not Available | 887 | Open in IMG/M |
3300027759|Ga0209296_1062835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
3300027763|Ga0209088_10019859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3490 | Open in IMG/M |
3300027769|Ga0209770_10290593 | Not Available | 625 | Open in IMG/M |
3300027769|Ga0209770_10366018 | Not Available | 538 | Open in IMG/M |
3300027770|Ga0209086_10355287 | Not Available | 605 | Open in IMG/M |
3300028394|Ga0304730_1031260 | All Organisms → Viruses → Predicted Viral | 2752 | Open in IMG/M |
3300032092|Ga0315905_10145712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2363 | Open in IMG/M |
3300033994|Ga0334996_0007644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7273 | Open in IMG/M |
3300034082|Ga0335020_0236047 | Not Available | 907 | Open in IMG/M |
3300034102|Ga0335029_0214436 | Not Available | 1268 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 17.48% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.59% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 12.62% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.71% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 7.77% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 4.85% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.88% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.88% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.88% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.94% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.97% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.97% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J40625_1007346752 | 3300002835 | Freshwater | MSDYKQRLDSIMLQLQTIIDEEYEDNANIQDAFNALACALDEEIIS* |
Ga0065166_101331742 | 3300004112 | Freshwater Lake | MLTYKQRLDSIMLQLQDIIDEEYEENDNVQTAFNNLAVVLDDNPVDNQ* |
Ga0049080_100088255 | 3300005582 | Freshwater Lentic | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0078894_100715594 | 3300005662 | Freshwater Lake | MSEYKKRLDNALIQLQAIIDEHYEDNDNVQDAFNMLAVVLDEESE* |
Ga0078894_101278986 | 3300005662 | Freshwater Lake | MSDYKQRLDNALVQLQYILDEQFEDNEDIQNAFNALACALDYYVEEE* |
Ga0078894_101624653 | 3300005662 | Freshwater Lake | MLTYKQRLDSIMLQLQDIIEEEYEDNDYVQTAFNNLAVVLDDNPVDNQ* |
Ga0078894_101661776 | 3300005662 | Freshwater Lake | MSDYKQRLDNIMLQLQAIIDEEYEENDCIQTAFNALACALDDVVE* |
Ga0078894_102506945 | 3300005662 | Freshwater Lake | MLDYKQRLDSIMLQLQSIIDEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0078894_102979974 | 3300005662 | Freshwater Lake | MLTYKQKLDQAMLALQTLIDERLEEDDAVQTAFNDLACALDDVVN* |
Ga0078894_104627605 | 3300005662 | Freshwater Lake | RLDNIMLQLQAIIDEEYEENDVIQTAFNNLAIALDEEIIS* |
Ga0078894_108983553 | 3300005662 | Freshwater Lake | MQDYKQRLDNIMLQLQSIIEEEFEEHNAIQTAFNNLACALDEELYE* |
Ga0078894_110274672 | 3300005662 | Freshwater Lake | MQDYKQRLDNIMLQLQSIIEEEYEEHNAIQTAFNALACALDEEHYKA* |
Ga0078894_113424442 | 3300005662 | Freshwater Lake | MLTYKQRLDNIMLQLQTIIDEEYEENDYVQTAFNNLAIILDDNPPDNT* |
Ga0070743_101111321 | 3300005941 | Estuarine | RLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0070744_100391642 | 3300006484 | Estuarine | MLDYKQRLDNVMLQLQSIIDEEYEDNDNVQDAFNMLAVVLDEETARSVNR* |
Ga0070744_100563821 | 3300006484 | Estuarine | QRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPV* |
Ga0070744_100600604 | 3300006484 | Estuarine | MLEYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLA |
Ga0070744_101573973 | 3300006484 | Estuarine | MLDYKQRLDNAMLQLQFIIDEDYEDNDNVQDAFNMLAVVLDEETARSINR* |
Ga0070744_102051262 | 3300006484 | Estuarine | QRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPA* |
Ga0070744_102144753 | 3300006484 | Estuarine | MLDYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNP |
Ga0075471_103798241 | 3300006641 | Aqueous | MSDYKQRLDNIMLQLQIIIDEEYEDNDSVQDAFNNLAIVLDGESE* |
Ga0075471_105460741 | 3300006641 | Aqueous | MLDYKQRLDNAMLQLQMIIDEEYEDNDNIQTAFNNLAEALDNPDNQ* |
Ga0075473_101369043 | 3300006875 | Aqueous | MLTYKQRLDNALLQLQYIIDEEYEENDRVQTAFNNLAIILDDNPPDNQ* |
Ga0102828_10319472 | 3300007559 | Estuarine | MLEYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0102828_10355151 | 3300007559 | Estuarine | MLDYKQRLDSIMLQLQALIDEEYEDNDYVQTAFNNLACTLDDNPV* |
Ga0102913_10567132 | 3300007560 | Estuarine | MLDYRQRLDSIMLQLQEIIEEEYEDNDNVQDAFNMLAVVLDEETARSINR* |
Ga0102915_12362121 | 3300007562 | Estuarine | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIISDDNPV* |
Ga0102917_12491921 | 3300007590 | Estuarine | MLDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0102923_11065772 | 3300007606 | Estuarine | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLACTLDDNPV* |
Ga0102902_12257111 | 3300007644 | Estuarine | DYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPV* |
Ga0102868_11203621 | 3300007653 | Estuarine | LFNKKELIMQNYKQRLDNAMLQLQYIIDEEYEENDYVQTAFNNLAII |
Ga0102910_11280331 | 3300007667 | Estuarine | MLDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDD |
Ga0102891_12358452 | 3300008950 | Estuarine | RLDSIMLQLQSIIDEEYEDNDVIQDAFNNLACILDGESE* |
Ga0102811_13605762 | 3300009024 | Estuarine | MLDYKQRLDSIMLQLQALIDEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0102829_13237562 | 3300009026 | Estuarine | MLDYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPV* |
Ga0102830_11925531 | 3300009059 | Estuarine | MLDYKQRLDSIMLQLQEIIDEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0114978_100303083 | 3300009159 | Freshwater Lake | LLNRKQKGDINMLDYKQRLDNAMLQLQMIIDEEYEDNDNVQTAFNNLAVALDEETARSINS* |
Ga0114966_103662801 | 3300009161 | Freshwater Lake | MQDYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPA* |
Ga0114975_100207746 | 3300009164 | Freshwater Lake | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLACILDDNPV* |
Ga0114982_10110571 | 3300009419 | Deep Subsurface | MQDYKQRLDSIMLQLQMIIDEEFEDNDLVQDAFNNLAVVLDDNPV* |
Ga0114982_10761382 | 3300009419 | Deep Subsurface | MSDYKQRLDSIMLQLQDIIEEEYEDNDYVQTAFNNLACILDDNPV* |
Ga0114982_11177911 | 3300009419 | Deep Subsurface | MSEYKQRLDSLMLQLQTLIDEDYEDNVTIQDAFNNLAIALDAEII* |
Ga0114967_100206282 | 3300010160 | Freshwater Lake | MSDYKQRLDNALIQLQYIIDEEFEDNQTVQDAFNNLAIILDGESE* |
Ga0114967_104777041 | 3300010160 | Freshwater Lake | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLA |
Ga0129333_101359273 | 3300010354 | Freshwater To Marine Saline Gradient | MLEYKQRLDNIMLQLQTIIDEEYEENDRVQTAFNNLAVVLDEEYARNII* |
Ga0157138_10125892 | 3300012352 | Freshwater | MSDYKQRLDNIMLQLQAIIEEEYEEHNAIQTAFNNLACALDEELYANN* |
Ga0157138_10353232 | 3300012352 | Freshwater | MLTYKQRLDNIMLQLQTIIDEEYEENDCIQTAFNALACALDDVVE* |
Ga0157138_10795372 | 3300012352 | Freshwater | MSDYKHRLDNALVQLQYIIDEQFEDNQTVQDAFNNLAIILDGEYEE* |
Ga0157203_100014455 | 3300012663 | Freshwater | MQDYTQRLDNIMLQLQSILDEEYEDNDKIQTAFNNLAIALDEELGV* |
Ga0157203_10075923 | 3300012663 | Freshwater | MSDYTQRLDSIMLQLQEIIDEEYEDNNKIQTAFNNLAIALDEELGV* |
Ga0157210_10039443 | 3300012665 | Freshwater | MLTYKQKLDQAMLALQTVIDERLEEDDTVQTAFNDLACALDDVVE* |
Ga0157210_10092022 | 3300012665 | Freshwater | MSDYRQRLDNALVQLQYILDEQFEDNEDIQNAFNALACALDYHVEEE* |
Ga0157210_10359373 | 3300012665 | Freshwater | MSDYKQRLDSIMLQLQEIIDEEYEDNDYVQTAFNNLAIILDDNPV* |
Ga0164292_105414991 | 3300013005 | Freshwater | LDYKQRLDNAMLQLQFIIEEEYEDNDRVQTAFNNLAVALDEETARSNS* |
Ga0211732_15373942 | 3300020141 | Freshwater | MLDYKQRLDNAMLQLQYIIDEEYEDNDNVQDAFNMLAVVLDEETARSINS |
Ga0211732_15578361 | 3300020141 | Freshwater | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQDAFNNLAIILDDNPV |
Ga0211736_108502562 | 3300020151 | Freshwater | MLDYKQRLDNAMLQLQYIIDEEYEDNDNVQDAFNMLAVVLDEETARSIKE |
Ga0211736_109369273 | 3300020151 | Freshwater | MSDYKQRLDNALVQLQYIIDEEFEDNQTVQDAFNNLAIILDGESE |
Ga0211736_110336412 | 3300020151 | Freshwater | MLDYKQKMDSIMLQLQSLIDEEYEDNDYVQTAFNNLAIALDNPDNE |
Ga0211734_101540251 | 3300020159 | Freshwater | MSDYKQRLDSIMLQLQEIIDEEYEDNDYVQTAFNNLAIILDDNPV |
Ga0211734_111041121 | 3300020159 | Freshwater | MLDYKQRLDNAMLQLQYIIDEEYEDNDNVQDAFNMLAVVIDEETARSNS |
Ga0211733_105688181 | 3300020160 | Freshwater | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV |
Ga0211729_106912381 | 3300020172 | Freshwater | MSDYQKRLDSIMLQLQTIIDEEYEDNDNVQTAFNNLAIALDDEYNECYNINNTR |
Ga0211731_105068701 | 3300020205 | Freshwater | MLDYKQRLDNAMLQLQYIIDEDYEDNDNVQDAFNMLAVVLDEETARSINS |
Ga0208201_1038362 | 3300020480 | Freshwater | MSEYKKRLDNALIQLQAIIDEQYEDNDNVQDAFNMLAVVLDEESE |
Ga0213921_10497082 | 3300021952 | Freshwater | MSDYKQRLDNALIQLQYIIDEEYEDNEAIQTAFNNLAIVLDGEYDE |
Ga0213922_10025554 | 3300021956 | Freshwater | MSDYKHRLDNALIQLQYIIDEEFEDNQTVQDAFNNLACALDGEYDEE |
Ga0213922_10082514 | 3300021956 | Freshwater | MQDYKQRLDNAMLQLQAIIDEEYEENDNIQTAFNDLACALDEELE |
Ga0213922_10113244 | 3300021956 | Freshwater | MPDYKQRLDNALIQLQYIIDEQYEDNDAIQTAFNNLALALDEEDNT |
Ga0222714_1001166221 | 3300021961 | Estuarine Water | MSDYKQRLDNIMLQLQIIIDEEYEENDVIQTAFNNLACALDEEIIS |
Ga0222712_104635723 | 3300021963 | Estuarine Water | MSDNKSKLDNLMLQIQEIIDEDYEDNDYLQTAFNNLAIALDDIIA |
Ga0222712_106194941 | 3300021963 | Estuarine Water | MSEYKQRLDNAMLQLQAIIDEEYEENDYVQTAFNNLAIILDDNPPDNQ |
Ga0222712_107451681 | 3300021963 | Estuarine Water | MQDYRQRLDNIMLQLQIIIDEEYEDNDRVQTAFNNLAIVLDGESE |
Ga0228703_100985212 | 3300022747 | Freshwater | MSDYKQRLDNALIQLQYIIDEQYEDNDAVQTAFNNLAIVLDGEYDE |
Ga0244777_100605935 | 3300024343 | Estuarine | MLDYKQRLDNAMLQLQFIIDEDYEDNDNVQDAFNMLAVVLDEETARSINR |
Ga0244777_105729291 | 3300024343 | Estuarine | MLDYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPV |
Ga0244775_100904213 | 3300024346 | Estuarine | MLDYKQRLDSIMLQLQEIIDEEYEDNDYVQTAFNNLAIILDDNPV |
Ga0244775_102701793 | 3300024346 | Estuarine | MQDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV |
Ga0244775_103721122 | 3300024346 | Estuarine | MLDYKQRLDNVMLQLQSIIDEEYEDNDNVQDAFNMLAVVLDEETARSVNR |
Ga0244775_111228561 | 3300024346 | Estuarine | EYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPA |
Ga0244776_102667582 | 3300024348 | Estuarine | MLEYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPV |
Ga0208783_102313901 | 3300025872 | Aqueous | MQNYKQRLDNAMLQLQMIIDEEYEDNDNIQTAFNNLAEALDNPDNQ |
Ga0208800_10615181 | 3300027193 | Estuarine | MLDYKQRLDSIMLQLQALIDEEYEDNDYVQTAFNNLACTLDDNPV |
Ga0255129_10526953 | 3300027286 | Freshwater | TQRLDNIMLQLQSILDEEYEDNNKIQTAFNNLAIALDEELGV |
Ga0255134_10182481 | 3300027292 | Freshwater | NSLLSSKRIIMLEYTQRLDNIMLQLQSILDEEYEDNNKIQTAFNNLAIALDEELGV |
Ga0208923_10846191 | 3300027320 | Estuarine | YKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV |
Ga0255118_10224214 | 3300027593 | Freshwater | YTQRLDNIMLQLQSILDEEYEDNNKIQTAFNNLAIALDEELGV |
Ga0255121_10125487 | 3300027598 | Freshwater | MLQLQSILDEEYEDNNKIQTAFNNLAIALDEELGV |
Ga0208133_10538583 | 3300027631 | Estuarine | IMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPV |
Ga0208133_11153332 | 3300027631 | Estuarine | MLEYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPA |
Ga0209599_100200314 | 3300027710 | Deep Subsurface | MQDYKQRLDSIMLQLQMIIDEEFEDNDLVQDAFNNLAVVLDDNPV |
Ga0209599_100870573 | 3300027710 | Deep Subsurface | MSEYKQRLDSLMLQLQTLIDEDYEDNVTIQDAFNNLAIALDAEII |
Ga0209442_11530032 | 3300027732 | Freshwater Lake | MSDYKQRLDNIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPV |
Ga0209296_10628356 | 3300027759 | Freshwater Lake | MLDYKQRLDNAMLQLQMIIDEEYEDNDNVQTAFNNLAVALDEETARSINS |
Ga0209088_100198593 | 3300027763 | Freshwater Lake | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLACILDDNPV |
Ga0209770_102905932 | 3300027769 | Freshwater Lake | MSDYKQRLDSIMLQLQEIIEEEYEDNDYVQTAFNNLAVVLDDNPVDNQ |
Ga0209770_103660182 | 3300027769 | Freshwater Lake | MSDYKQRLDNAFVQLQYIIDEQFEDNEDIQNAFNALACALDYYVEEE |
Ga0209086_103552872 | 3300027770 | Freshwater Lake | MQDYKQRLDSIMLQLQAIIDEEYEDNDYVQTAFNNLACTLDDNPA |
Ga0304730_10312601 | 3300028394 | Freshwater Lake | MSDYKQRLDNALIQLQYIIDEEFEDNQTVQDAFNNLAIILDGESE |
Ga0315905_101457126 | 3300032092 | Freshwater | MLTYKQKLDQAMLALQTLIDERLEEDDAVQTAFNDLACALDDVVN |
Ga0334996_0007644_6598_6738 | 3300033994 | Freshwater | MSDYKQRLDSIMLQLQTIIDEEYEDNANIQDAFNALACALDEEIIS |
Ga0335020_0236047_599_736 | 3300034082 | Freshwater | MLTYKQRLDNIMLQLQEIIEEEYEDNDYVQTAFNNLAIILDDNPA |
Ga0335029_0214436_718_855 | 3300034102 | Freshwater | MLTYKQKLDSLMLQLQEIIDEEYEDNDYVQTAFNNLAIILDDNPV |
⦗Top⦘ |