Basic Information | |
---|---|
Family ID | F099067 |
Family Type | Metagenome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | GRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.03 % |
% of genes from short scaffolds (< 2000 bps) | 85.44 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.058 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.155 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.544 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.340 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.12% Coil/Unstructured: 80.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF03309 | Pan_kinase | 61.17 |
PF05635 | 23S_rRNA_IVP | 11.65 |
PF01040 | UbiA | 4.85 |
PF01797 | Y1_Tnp | 2.91 |
PF02517 | Rce1-like | 2.91 |
PF00877 | NLPC_P60 | 2.91 |
PF01966 | HD | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 61.17 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 2.91 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 2.91 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.91 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 2.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.06 % |
Unclassified | root | N/A | 1.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001661|JGI12053J15887_10150002 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300002561|JGI25384J37096_10176016 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300002908|JGI25382J43887_10222189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 891 | Open in IMG/M |
3300004006|Ga0055453_10189272 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005166|Ga0066674_10121585 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1221 | Open in IMG/M |
3300005174|Ga0066680_10421964 | Not Available | 845 | Open in IMG/M |
3300005179|Ga0066684_10887439 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
3300005439|Ga0070711_101902707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
3300005445|Ga0070708_101106510 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300005446|Ga0066686_10703995 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
3300005468|Ga0070707_102242344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300005536|Ga0070697_101682730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
3300005540|Ga0066697_10050961 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
3300005540|Ga0066697_10357396 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300005552|Ga0066701_10000283 | All Organisms → cellular organisms → Bacteria | 13587 | Open in IMG/M |
3300005557|Ga0066704_10818474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
3300005558|Ga0066698_10849541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
3300005568|Ga0066703_10053200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2273 | Open in IMG/M |
3300005568|Ga0066703_10313229 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300006032|Ga0066696_10034325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2742 | Open in IMG/M |
3300006791|Ga0066653_10054484 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
3300006796|Ga0066665_10312415 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300006796|Ga0066665_11607341 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300006797|Ga0066659_10084838 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
3300006797|Ga0066659_10655785 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300006800|Ga0066660_11603723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
3300006804|Ga0079221_10948992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 638 | Open in IMG/M |
3300006871|Ga0075434_100594646 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300006903|Ga0075426_10041440 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
3300006903|Ga0075426_10442885 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300009012|Ga0066710_103450067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300009137|Ga0066709_101207248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1113 | Open in IMG/M |
3300009137|Ga0066709_102256973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 748 | Open in IMG/M |
3300009792|Ga0126374_11513324 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300010301|Ga0134070_10247835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
3300010303|Ga0134082_10174387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 875 | Open in IMG/M |
3300010323|Ga0134086_10255876 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 668 | Open in IMG/M |
3300010333|Ga0134080_10312659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
3300010333|Ga0134080_10695937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
3300010364|Ga0134066_10321066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
3300010401|Ga0134121_11078610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 794 | Open in IMG/M |
3300012198|Ga0137364_10320748 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300012198|Ga0137364_10512929 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300012198|Ga0137364_10972996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 642 | Open in IMG/M |
3300012201|Ga0137365_10259028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1293 | Open in IMG/M |
3300012203|Ga0137399_10354431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1219 | Open in IMG/M |
3300012203|Ga0137399_10395810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1152 | Open in IMG/M |
3300012206|Ga0137380_10782595 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 824 | Open in IMG/M |
3300012207|Ga0137381_10213444 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300012207|Ga0137381_11006512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 719 | Open in IMG/M |
3300012208|Ga0137376_10036561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3939 | Open in IMG/M |
3300012208|Ga0137376_10368233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1248 | Open in IMG/M |
3300012209|Ga0137379_11282563 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 638 | Open in IMG/M |
3300012210|Ga0137378_11692192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
3300012285|Ga0137370_10696981 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
3300012349|Ga0137387_10080705 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
3300012350|Ga0137372_10482857 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300012354|Ga0137366_10846500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 648 | Open in IMG/M |
3300012358|Ga0137368_10111014 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
3300012532|Ga0137373_11013115 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012927|Ga0137416_10349681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1239 | Open in IMG/M |
3300012930|Ga0137407_12210102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
3300012972|Ga0134077_10375852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
3300014157|Ga0134078_10082921 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300015241|Ga0137418_10267983 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300017654|Ga0134069_1128361 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300017656|Ga0134112_10357029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
3300017659|Ga0134083_10194579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 835 | Open in IMG/M |
3300018054|Ga0184621_10028670 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
3300018071|Ga0184618_10057902 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300018071|Ga0184618_10125395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1030 | Open in IMG/M |
3300018079|Ga0184627_10456353 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300018431|Ga0066655_10007368 | All Organisms → cellular organisms → Bacteria | 4596 | Open in IMG/M |
3300018468|Ga0066662_10989812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
3300018482|Ga0066669_11110565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 713 | Open in IMG/M |
3300019789|Ga0137408_1125240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1032 | Open in IMG/M |
3300019879|Ga0193723_1012263 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
3300020170|Ga0179594_10234443 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300021363|Ga0193699_10395817 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
3300025910|Ga0207684_10794468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 800 | Open in IMG/M |
3300025928|Ga0207700_10910471 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 787 | Open in IMG/M |
3300026298|Ga0209236_1215581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 683 | Open in IMG/M |
3300026310|Ga0209239_1168923 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300026326|Ga0209801_1026518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2781 | Open in IMG/M |
3300026327|Ga0209266_1179204 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 805 | Open in IMG/M |
3300026328|Ga0209802_1209531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 738 | Open in IMG/M |
3300026332|Ga0209803_1262141 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300026342|Ga0209057_1139931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 831 | Open in IMG/M |
3300026529|Ga0209806_1341504 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300026530|Ga0209807_1204134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 691 | Open in IMG/M |
3300026536|Ga0209058_1209911 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300026537|Ga0209157_1111994 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300026538|Ga0209056_10010974 | All Organisms → cellular organisms → Bacteria | 9168 | Open in IMG/M |
3300027748|Ga0209689_1191205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 911 | Open in IMG/M |
3300027765|Ga0209073_10001861 | All Organisms → cellular organisms → Bacteria | 4505 | Open in IMG/M |
3300028536|Ga0137415_10207458 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300028784|Ga0307282_10154960 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300028814|Ga0307302_10429770 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
3300032180|Ga0307471_104218895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
3300032770|Ga0335085_11114931 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300033815|Ga0364946_124138 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300034114|Ga0364938_000363 | All Organisms → cellular organisms → Bacteria | 4471 | Open in IMG/M |
3300034177|Ga0364932_0087197 | Not Available | 1183 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.16% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.91% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_101500021 | 3300001661 | Forest Soil | AAFAARDWLLGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
JGI25384J37096_101760162 | 3300002561 | Grasslands Soil | DWLCGRQIRTPLSGRAAGIRPDGALLVETDAGSGVVRDGHVELS* |
JGI25382J43887_102221891 | 3300002908 | Grasslands Soil | AARDWLHGRMLRSPAPGLACGIRPDGALLVDAGTGTIGVREGHVELA* |
Ga0055453_101892722 | 3300004006 | Natural And Restored Wetlands | RDRLLRHPVAGRAAGLRSDGALLVETAAASTAVREGHVELA* |
Ga0066674_101215851 | 3300005166 | Soil | RQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0066680_104219642 | 3300005174 | Soil | RDWLHGRMLRSPAQGLARGIRPDGALLVDAGTGTIGVREGHVELA* |
Ga0066684_108874391 | 3300005179 | Soil | WLRGRRIRAPVPGRADGVLPDGALRVNLGAGTVTVREGHVELA* |
Ga0070711_1019027071 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0070708_1011065101 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DWLRGRLLRAPVYGRAAGVRPDGALLVEGQGGTTAAREGHVELA* |
Ga0066686_107039952 | 3300005446 | Soil | AFAARDWLQGRQLRSPAAGRARGLRPDGALLIDLGAATIAVREGHVELA* |
Ga0070707_1022423441 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0070697_1016827302 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0066697_100509614 | 3300005540 | Soil | DWLRGRQLRSPAAGRAGGLRPDGALLVDLGAGTIGVREGHVELA* |
Ga0066697_103573961 | 3300005540 | Soil | AARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0066701_100002831 | 3300005552 | Soil | SPAAGRAGGLRPDGALLVDLGAGTIGVREGHVELA* |
Ga0066704_108184741 | 3300005557 | Soil | PAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0066698_108495411 | 3300005558 | Soil | ARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0066703_100532004 | 3300005568 | Soil | RQLRSPAAGRARGLRPDGALLIDLGAATIGVREGHVELA* |
Ga0066703_103132292 | 3300005568 | Soil | IRTPLSGRAAGIRPDGALLVETDAGSGVVRDGHVELS* |
Ga0066696_100343251 | 3300006032 | Soil | WLRGRQLRSPAAGRAGGLRPDGALLVDLGAGTIGVREGHVELA* |
Ga0066653_100544841 | 3300006791 | Soil | IRTPLAGRAAGIRPDGALLVDTGAGTTMVQGGHVELS* |
Ga0066665_103124153 | 3300006796 | Soil | WLLGRQLRTPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0066665_116073411 | 3300006796 | Soil | QLKAPLFGRAAGIRADGTLLVDTGSGTTYAREGHVELA* |
Ga0066659_100848381 | 3300006797 | Soil | MRDWLRGRQLKAPLFGRAAGIRPDGTLLVDTGSGTTYAREGHVELA* |
Ga0066659_106557853 | 3300006797 | Soil | SERECAAFAARDWLLGRQLRAPAAGRAQGLRPDGALLVDLGAGTIALREGHVELA* |
Ga0066660_116037231 | 3300006800 | Soil | ECAAFAARDWLLGRQLRTPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0079221_109489922 | 3300006804 | Agricultural Soil | WLRGRQLRAPAVGRAQGVRPDGALLVDLGAGTIALREGHVELA* |
Ga0075434_1005946461 | 3300006871 | Populus Rhizosphere | RDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0075426_100414401 | 3300006903 | Populus Rhizosphere | PLTGRAAGIRPDGALLVDTGAGTTMVQGGHVELS* |
Ga0075426_104428854 | 3300006903 | Populus Rhizosphere | LRGRQLRAPAVGRAQGVRPDGALLIDLGAGTIALREGHVELA* |
Ga0066710_1034500671 | 3300009012 | Grasslands Soil | ARDWLHGRMLRSPAQGLARGIRPDGALLVDAGTGTIGVREGHVELA |
Ga0066709_1012072483 | 3300009137 | Grasslands Soil | ARDWLHGRMLRSPAQGLARGIRPDGALLVDAGTGTIGVREGHVELA* |
Ga0066709_1022569732 | 3300009137 | Grasslands Soil | ERECAAFAARDWLLGRQLRTPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0126374_115133241 | 3300009792 | Tropical Forest Soil | RALRSPVAGHARGVRPDGALLVEGEGDVAVVREGHVETA* |
Ga0134070_102478351 | 3300010301 | Grasslands Soil | WLRGRRIRAPVPGRAGGLRQDGALLVDLGAGTVSVREGHVELA* |
Ga0134082_101743873 | 3300010303 | Grasslands Soil | APAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0134086_102558762 | 3300010323 | Grasslands Soil | LREPAVGRAGGLRPDGALLVDLGAGTIGVREGHVELA* |
Ga0134080_103126592 | 3300010333 | Grasslands Soil | AAFAARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0134080_106959371 | 3300010333 | Grasslands Soil | LRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0134066_103210662 | 3300010364 | Grasslands Soil | WLRGRQLRSPAAGRARGLRPDGALLIDLGAATIGVREGHVELA* |
Ga0134121_110786101 | 3300010401 | Terrestrial Soil | QLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137364_103207481 | 3300012198 | Vadose Zone Soil | LSERECAAFAARDWLQGRQLRSPAAGRARGLRADGALLVDLGAATIAVREGHVELA* |
Ga0137364_105129291 | 3300012198 | Vadose Zone Soil | RDWLRGRHIRAPLVGRASGIRPDGALLVDTGAGTTMVRDGHVELS* |
Ga0137364_109729962 | 3300012198 | Vadose Zone Soil | AFTARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137365_102590281 | 3300012201 | Vadose Zone Soil | LGRQLRTPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137399_103544311 | 3300012203 | Vadose Zone Soil | GRQLRAPLFGRAAGVRADGALLVDTGVATAGGREGHVELA* |
Ga0137399_103958101 | 3300012203 | Vadose Zone Soil | TPLAGRAAGIRPDGALLVDTGAGTTMVRDGHVELS* |
Ga0137380_107825952 | 3300012206 | Vadose Zone Soil | FAARDWLQGRQLRSPAVGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137381_102134443 | 3300012207 | Vadose Zone Soil | LRGRRIRAPVPGRAGGLRQDGALLVDLGAGTVSVREGHVELA* |
Ga0137381_110065122 | 3300012207 | Vadose Zone Soil | ERTLKAPVPGRAIGIRADGALLVRDAAGTVAVREGHVELA* |
Ga0137376_100365617 | 3300012208 | Vadose Zone Soil | AFALRDWLRGRQLRSPAAGRAGGLRPDGALLVDLGAGTIGVREGHVELA* |
Ga0137376_103682333 | 3300012208 | Vadose Zone Soil | RDWLQGRQLRSPAAGRARGLRADGALLVDLGAATIAVREGHVELA* |
Ga0137379_112825631 | 3300012209 | Vadose Zone Soil | GRQLRSPAVGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137378_116921921 | 3300012210 | Vadose Zone Soil | WLLGRQLRAPAAGRARGLRPDGALLVDLGAATVAVREGHVELA* |
Ga0137370_106969812 | 3300012285 | Vadose Zone Soil | WLQGRQLRSPAAGRARGLRADGALLVDLGAATIAVREGHVELA* |
Ga0137387_100807054 | 3300012349 | Vadose Zone Soil | FAARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137372_104828572 | 3300012350 | Vadose Zone Soil | PERAAFAARDWLCGRRIRAPVPGRAGGLRQDGALLVDLGAGTVSVREGHVELA* |
Ga0137366_108465001 | 3300012354 | Vadose Zone Soil | HGRQLRAPAVGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137368_101110144 | 3300012358 | Vadose Zone Soil | IRTPLAGRASGIRPDGALLVDTGTGTTMVRDGHVELS* |
Ga0137373_110131151 | 3300012532 | Vadose Zone Soil | RQIRTPLAGRAAGIRPDGALLVDTGAGTTMVQGGHVELS* |
Ga0137416_103496813 | 3300012927 | Vadose Zone Soil | RDWLRGRQLRAPAAGRAGGLRPDGALLVDLGAGTIGVREGHVELA* |
Ga0137407_122101021 | 3300012930 | Vadose Zone Soil | RGRQLRSPAAGRARGLRPDGALLIDLGAATIGVREGHVELA* |
Ga0134077_103758521 | 3300012972 | Grasslands Soil | FAERDWLRGRQLRSPAAGRAGGVRPDGALLVDLGAGTIGVREGHVELA* |
Ga0134078_100829213 | 3300014157 | Grasslands Soil | TPAAGRARGLRPDGALLVDLGAATIAVREGHVELA* |
Ga0137418_102679833 | 3300015241 | Vadose Zone Soil | QIRTPLAGRAAGIRPDGALLVDTGAGTTMVRDGHVELS* |
Ga0134069_11283611 | 3300017654 | Grasslands Soil | SPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0134112_103570292 | 3300017656 | Grasslands Soil | AARDWLQGRQLRSPASGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0134083_101945792 | 3300017659 | Grasslands Soil | GRMLRSPAAGLARGIRPDGALLVDAGAGTVGVREGHVELA |
Ga0184621_100286703 | 3300018054 | Groundwater Sediment | RGRQIRSPIPGRAVGVRPDGALLVDTGAGTTMVREGHVELS |
Ga0184618_100579021 | 3300018071 | Groundwater Sediment | IRTPLAGRASGICPDGALLVDTGAGTTMVRDGHVELS |
Ga0184618_101253951 | 3300018071 | Groundwater Sediment | GRQLRSPAAGRAGGLRPDGALLVDLGAGTIAVRDGHVELA |
Ga0184627_104563532 | 3300018079 | Groundwater Sediment | LRGRQIRAPIAGRAAGVRPDGALLVDTGAGTTMVREGHVELS |
Ga0066655_100073687 | 3300018431 | Grasslands Soil | SPAAGRAGGLRPDGALLVDLGAGTIGVREGHVELA |
Ga0066662_109898122 | 3300018468 | Grasslands Soil | QLRTPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0066669_111105651 | 3300018482 | Grasslands Soil | GRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0137408_11252403 | 3300019789 | Vadose Zone Soil | RQIRAPLAGRASGIRPDGALLVDTGAGTTMVREGHVELS |
Ga0193723_10122635 | 3300019879 | Soil | QIRAPLAGRASGIRPDGALLVDTGAGTTMVRGGHVELS |
Ga0179594_102344432 | 3300020170 | Vadose Zone Soil | GRQIRTPLAGRASGIRPDGALLVDTGAGTTMVRDGHVELS |
Ga0193699_103958172 | 3300021363 | Soil | ERDWLRGRDLRAPAAGRARGVTPDGALLVEMGADTVAVREGHVELV |
Ga0207684_107944681 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0207700_109104712 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | CAAFAARDWLRGRQLRAPAVGRAQGVRPDGALLVDLGAGTIALREGHVELA |
Ga0209236_12155811 | 3300026298 | Grasslands Soil | QGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0209239_11689231 | 3300026310 | Grasslands Soil | QIRTPLTGRAAGIRPDGALLVDTGAGTTMVQGGHVELS |
Ga0209801_10265185 | 3300026326 | Soil | WLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0209266_11792041 | 3300026327 | Soil | LQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0209802_12095311 | 3300026328 | Soil | WLHGRMLRSPAQGLARGIGPDGALLVDAGTGTIGVREGHVELA |
Ga0209803_12621411 | 3300026332 | Soil | TPLAGRASGIRPDGALLVDTGAGTTMVRDGHVELS |
Ga0209057_11399311 | 3300026342 | Soil | QLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0209806_13415041 | 3300026529 | Soil | APLFGRAAGVRADGALLVDTGVATAGVREGHVELA |
Ga0209807_12041342 | 3300026530 | Soil | ARDWLLGRQLRTPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0209058_12099112 | 3300026536 | Soil | RIRAPVPGRAGGLRQDGALLVDLGAGTVSVREGHVELA |
Ga0209157_11119943 | 3300026537 | Soil | LRGRQIRTPLAGRAAGIRPDGALLVDTGAGTTMVRDGHVELS |
Ga0209056_100109741 | 3300026538 | Soil | CAAFAARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0209689_11912052 | 3300027748 | Soil | EAECAAFAARDWLHGRMLRSPAPGLACGIRPDGALLVDAGTGTIGVREGHVELA |
Ga0209073_100018617 | 3300027765 | Agricultural Soil | LLGRQLRAPAAGRARGLRPDGALLVDLGPATVAVREGHVELA |
Ga0137415_102074581 | 3300028536 | Vadose Zone Soil | FAARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0307282_101549602 | 3300028784 | Soil | ERECAAFAAPDWLHGRQLRSPAAGRAGGLRPDGALLVDLGVGTIAVRDGHVELA |
Ga0307302_104297701 | 3300028814 | Soil | LHGRQLRSPAAGRAGGLRPDGALLVDLGAGTIAVRDGHVELA |
Ga0307471_1042188952 | 3300032180 | Hardwood Forest Soil | AFAARDWLQGRQLRSPAAGRARGLRPDGALLVDLGAATIAVREGHVELA |
Ga0335085_111149312 | 3300032770 | Soil | RLRGRELRAPRAGRAAGLARDGALLVETDRGLVPVREGHVELA |
Ga0364946_124138_1_120 | 3300033815 | Sediment | RQIRTPLFGRAAGIGPDGALLVDTGAGTTMVRDGHVELS |
Ga0364938_000363_26_217 | 3300034114 | Sediment | LATHHSGLTESECAAYAGRDWLRDRELRHPVAGRAIGLRADGALLIETAAAPTAVREGHVELA |
Ga0364932_0087197_2_187 | 3300034177 | Sediment | THGSGLSESECAAYAGRDWLRDRELRRPVAGRAVGLRADGALLVGTAAAPTAVREGHVEL |
⦗Top⦘ |