NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099032

Metagenome / Metatranscriptome Family F099032

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099032
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 49 residues
Representative Sequence PARFRSRCYEGIGTILGAMHRYGPERKAACNRATPARYRADCYRGAAIT
Number of Associated Samples 97
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.26 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.320 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.184 % of family members)
Environment Ontology (ENVO) Unclassified
(34.951 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.515 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.56%    β-sheet: 0.00%    Coil/Unstructured: 58.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF08241Methyltransf_11 66.02
PF01458SUFBD 23.30
PF00903Glyoxalase 2.91
PF02036SCP2 1.94
PF00248Aldo_ket_red 0.97
PF07995GSDH 0.97
PF08448PAS_4 0.97
PF14742GDE_N_bis 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0719Fe-S cluster assembly scaffold protein SufBPosttranslational modification, protein turnover, chaperones [O] 23.30
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.32 %
UnclassifiedrootN/A10.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_9155645All Organisms → cellular organisms → Bacteria1028Open in IMG/M
2228664021|ICCgaii200_c0770844All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300000890|JGI11643J12802_11015960All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300002568|C688J35102_120868700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia brevicatena1912Open in IMG/M
3300005169|Ga0066810_10123939Not Available595Open in IMG/M
3300005171|Ga0066677_10655448Not Available591Open in IMG/M
3300005176|Ga0066679_10950058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium538Open in IMG/M
3300005330|Ga0070690_100539514All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005337|Ga0070682_100381832All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300005338|Ga0068868_101074117All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005345|Ga0070692_11078434All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005437|Ga0070710_10815924All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005439|Ga0070711_100935534All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005454|Ga0066687_10259314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300005457|Ga0070662_100993989All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005526|Ga0073909_10475809All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005535|Ga0070684_101156765All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005549|Ga0070704_100219636All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300005577|Ga0068857_102390942All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005719|Ga0068861_100674058All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300006032|Ga0066696_10015914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3760Open in IMG/M
3300006046|Ga0066652_100694734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria968Open in IMG/M
3300006794|Ga0066658_10689333All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300006852|Ga0075433_11010501All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300006904|Ga0075424_101554079All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006914|Ga0075436_100035359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3447Open in IMG/M
3300006954|Ga0079219_11413833All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300007076|Ga0075435_101321617Not Available631Open in IMG/M
3300009098|Ga0105245_13276168All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009148|Ga0105243_11513567All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300009162|Ga0075423_11978121All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300009162|Ga0075423_12900254All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300009177|Ga0105248_10602730All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300009551|Ga0105238_10279124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1652Open in IMG/M
3300010036|Ga0126305_10482790All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300010039|Ga0126309_11093589Not Available541Open in IMG/M
3300010041|Ga0126312_10348362All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300010145|Ga0126321_1157871Not Available844Open in IMG/M
3300010360|Ga0126372_10660655All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300010360|Ga0126372_12405494All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010376|Ga0126381_103000181Not Available670Open in IMG/M
3300010403|Ga0134123_10246286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1552Open in IMG/M
3300012207|Ga0137381_11806652Not Available500Open in IMG/M
3300012209|Ga0137379_10512632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1107Open in IMG/M
3300012481|Ga0157320_1003575All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300012483|Ga0157337_1024214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium582Open in IMG/M
3300012497|Ga0157319_1032783All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300012503|Ga0157313_1041562All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012902|Ga0157291_10229172All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012907|Ga0157283_10271678All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300012955|Ga0164298_10766153All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300012984|Ga0164309_11013419All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300012985|Ga0164308_11947312All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012986|Ga0164304_10452778All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300015077|Ga0173483_10150722All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300015200|Ga0173480_10013347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3335Open in IMG/M
3300018051|Ga0184620_10080634All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300018054|Ga0184621_10259196All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300018465|Ga0190269_10032599All Organisms → cellular organisms → Bacteria2366Open in IMG/M
3300019361|Ga0173482_10057706All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300019868|Ga0193720_1009968All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300019885|Ga0193747_1097467Not Available714Open in IMG/M
3300021344|Ga0193719_10073447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1485Open in IMG/M
3300022756|Ga0222622_11038742All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300024283|Ga0247670_1020739All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300024287|Ga0247690_1003673All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300024325|Ga0247678_1001925All Organisms → cellular organisms → Bacteria2742Open in IMG/M
3300025899|Ga0207642_10617528All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300025907|Ga0207645_11201780All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025911|Ga0207654_10062381All Organisms → cellular organisms → Bacteria2184Open in IMG/M
3300025916|Ga0207663_10963427All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300025930|Ga0207701_10998017All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300025932|Ga0207690_11458395All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300025933|Ga0207706_10788776All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300025938|Ga0207704_11090339All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300025949|Ga0207667_10732130All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300026023|Ga0207677_10400296All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300026075|Ga0207708_10305922All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300026118|Ga0207675_100112317All Organisms → cellular organisms → Bacteria2571Open in IMG/M
3300026300|Ga0209027_1260156Not Available557Open in IMG/M
3300026306|Ga0209468_1095364Not Available968Open in IMG/M
3300027725|Ga0209178_1217191All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300028293|Ga0247662_1025306All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300028715|Ga0307313_10113263All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300028716|Ga0307311_10009341All Organisms → cellular organisms → Bacteria2299Open in IMG/M
3300028782|Ga0307306_10194375All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300028791|Ga0307290_10033481All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300028791|Ga0307290_10104800All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300028796|Ga0307287_10185337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300028807|Ga0307305_10221215All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300028814|Ga0307302_10161100All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300028819|Ga0307296_10017162All Organisms → cellular organisms → Bacteria3791Open in IMG/M
3300028819|Ga0307296_10146419All Organisms → cellular organisms → Bacteria1274Open in IMG/M
3300028828|Ga0307312_10163243All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300028876|Ga0307286_10163163All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300028876|Ga0307286_10303212All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300028885|Ga0307304_10212096All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300030496|Ga0268240_10107448All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300031421|Ga0308194_10239963Not Available603Open in IMG/M
3300031938|Ga0308175_100297083All Organisms → cellular organisms → Bacteria1645Open in IMG/M
3300031939|Ga0308174_11232217All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300032013|Ga0310906_10071733All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300032013|Ga0310906_11082146All Organisms → cellular organisms → Bacteria579Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012497Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_010927302088090015SoilGHCYEGVGTILGALHRLGAERRAACNAVTPSRYRGDCYRGAAIT
ICCgaii200_077084422228664021SoilRGHCYEGVGTILGALHRLGAERRAACNAVTPSRYRGDCYRGAAIT
JGI11643J12802_1101596013300000890SoilEAARLCNLAPARYRGHCYEGVGTILGALHRLGAERRAACNAVTPSRYRGDCYRGAAIT*
C688J35102_12086870013300002568SoilGPESSRFCAAAPVRFRARCYEGIGTILGAMHRYGAQRKAACNRAVPARYRADCYRGAAIT
Ga0066810_1012393913300005169SoilHLCTLGPARFRARCYEGIGTILGALHSLGSERRAACAQITPRRYRRDCLRGAAVL*
Ga0066677_1065544823300005171SoilYRPRCFEGIGTILGAIHRLGPDRKAACNEVTPARYRADCYRGAAVT*
Ga0066679_1095005823300005176SoilPKRYRGYCYEGIGTILGAINRFTPERKGACDKVTPRRYRADCYRGAAIT*
Ga0070690_10053951413300005330Switchgrass RhizosphereGIGTILGAMHRYGAERRAACDKATPKRYHADCYRGAAIT*
Ga0070682_10038183233300005337Corn RhizosphereYEGIGTILGAMHRYGAERRAACDKATPKRYHADCYRGAAIT*
Ga0068868_10107411723300005338Miscanthus RhizosphereGIGTILGAMHRYGPERRTACNRATPARYRDDCYRGAAIT*
Ga0070692_1107843413300005345Corn, Switchgrass And Miscanthus RhizosphereCYEGIGTILGSLHRSGAERRAACDAVTPKAYRRDCYRGAAVS*
Ga0070710_1081592413300005437Corn, Switchgrass And Miscanthus RhizosphereTRLCTASPPAFRGRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT*
Ga0070711_10093553413300005439Corn, Switchgrass And Miscanthus RhizosphereAARLCNLAPAAQRGRCFEGIGTILGTLHRYGNERKSACKAVTPARYRPDCYRGAAIT*
Ga0066687_1025931423300005454SoilVLCNDSPKRYRGYCYEGIGTILGAINRFTPERKGACDKVTPRRYRADCYRGAAIT*
Ga0070662_10099398913300005457Corn RhizosphereRCYEGIGTILGSLHRSGAERRAACDAVTPKAYRRDCYRGAAVS*
Ga0073909_1047580923300005526Surface SoilAPARFRPRCYEGIGTILGAMHRYGAERKAACKRATPARYRADCYRGAAIA*
Ga0070684_10115676523300005535Corn RhizosphereRCYEGIGTILGAMHRYGSERRAACNKATPSRYHADCYRGAAIT*
Ga0070704_10021963613300005549Corn, Switchgrass And Miscanthus RhizosphereAAQRGRCFEGIGTILGTLHRYGSERKAACKAVTPARYRPDCYRGAAIT*
Ga0068857_10239094213300005577Corn RhizosphereARCYEGIGTILGAMHRYGAERRAACNKATPKRYHADCYRGAAIT*
Ga0068861_10067405813300005719Switchgrass RhizosphereAAAARYRKRCYEGIGTILGSLHRSGAERRAACDAVTPKAYRRDCYRGAAVS*
Ga0066696_1001591463300006032SoilRYRPRCFEGIGTILGAIHRLGPDRKAACNEVTPARYRADCYRGAAVT*
Ga0066652_10069473423300006046SoilYCYQGFGTILGAINRETEGRKSACAKVTPRRYMRDCLRGAAVI*
Ga0066658_1068933323300006794SoilRYRARCYEGIGTILGALHRLGPDRRAACDAVTPKGYRNDCYRGAAVT*
Ga0075433_1101050123300006852Populus RhizosphereNYAGTKAATRLCAASPPAFRGRCYEGIGTILGSLHRYGPQRKAACNAITPAAYRRDCYRGAAVT*
Ga0075424_10155407923300006904Populus RhizosphereYEGIGTILGAMHRFGAERRAACKRATPARYRADCYRGAAIT*
Ga0075436_10003535973300006914Populus RhizosphereIGTILGSLHRSGAERRAACDAVTPGAYHRDCYRGAVVS*
Ga0079219_1141383313300006954Agricultural SoilCAATPAPYRGRCYEGTGTILGALHRYGGERKSACDAVTPKRYRADCYRGAAVT*
Ga0075435_10132161713300007076Populus RhizosphereCNDTPKRYRGYCYEGIGTILGAINRETEPRKNACDAVTPKQYRTDCYRGAAIS*
Ga0105245_1327616813300009098Miscanthus RhizosphereDAARFCAAAPARFRARCYEGIGTILGAMHRYGVERRAACNRATPARYRADCYRGAAIT*
Ga0105243_1151356723300009148Miscanthus RhizosphereAAPKRFRERCYEGIGTILGAMHREGLERRAACNRATPSRYRADCYRGAAIT*
Ga0075423_1197812123300009162Populus RhizosphereAPARFRARCYEGIGTILGAMHRFGAERRAACKRATPARYRADCYRGAAIT*
Ga0075423_1290025423300009162Populus RhizosphereGGPKSSAFCAASPARFRARCYEGIGTILGAMHRYGTERRAACDGAAPKRYRADCYRGAAIT*
Ga0105248_1060273033300009177Switchgrass RhizosphereGVKSTRFCASAPARFRARCYEGIGTILGAMHRYGSERRAACNKATPSRYHADCYRGAAIT
Ga0105238_1027912443300009551Corn RhizosphereFRPRCYEGIGTILGAMHRYGQERRTACNRATPARYRDDCYRGAAIT*
Ga0126305_1048279013300010036Serpentine SoilIGTILGSLHRSGAERRGACDAVTPKAYRRDCYRGAAVT*
Ga0126309_1109358913300010039Serpentine SoilQAARLCNLAPARHRAYCFEGVGTILGALHHVRSERRAACDAVTPRRYRGDCYRGAAIA*
Ga0126312_1034836233300010041Serpentine SoilRYRARCYEGIGTILGSLHRYGADRRAACDAVTPKRYRADCYRGAAVR*
Ga0126321_115787123300010145SoilCNLGPARYRGYCFEGVGTILGSLHRYGAQRRAACAAVTPRRYLADCLSGAAVTQ*
Ga0126372_1066065513300010360Tropical Forest SoilTASPVRFRGRCYEGIGTILGSLNRYGPQRRAACNAITPKAYRRDCYRGAAVT*
Ga0126372_1240549423300010360Tropical Forest SoilPATNRPRCYEGIGTILGSLHRYGDERKAACDSVTPKRYRPDCYRGAAIT*
Ga0126381_10300018113300010376Tropical Forest SoilYEGIGTILGAINRETEQRKSACDTVSPKRYLADCYRGAAIT*
Ga0134123_1024628613300010403Terrestrial SoilAAARFRPRCYEGIGTILGAMHRYGPDRRTACDRATPARYRDDCYRGAAIT*
Ga0137381_1180665213300012207Vadose Zone SoilNYAGGTQAAQLCNLSPLRYRGYCFEGVGTILGAIHRLGSDRKAACDQATPKRYRADCYRGAAV*
Ga0137379_1051263213300012209Vadose Zone SoilGYCYEGIGTILGAINRFTPERKGACDKVTPRRYRADCYRGAAIT*
Ga0157320_100357533300012481Arabidopsis RhizosphereCTSAPATYRPRCFEGIGTILGSLHRYGDERKAACNAVSPKRYRPDCYRGAAIT*
Ga0157337_102421413300012483Arabidopsis RhizosphereEGIGTILGAMHRYGAERRAACDKATPKRYHADCYRGAAIT*
Ga0157319_103278323300012497Arabidopsis RhizosphereRLCTASPPAFRGRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT*
Ga0157313_104156223300012503Arabidopsis RhizosphereSPPAFRGRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT*
Ga0157291_1022917223300012902SoilTAAPAPYRARCYEGIGTILGSLHRYGAERRAACDAITPKAYRADCYRGAAVT*
Ga0157283_1027167823300012907SoilTSTRVCTAAPAPYRARCYEGIGTILGSLHRYGAERRAACDAITPKAYRADCYRGAAVT*
Ga0164298_1076615323300012955SoilRCYEGIGTILGAMHRYGPDRRAACNRATPARYRDDCYRGAAIT*
Ga0164309_1101341923300012984SoilFCAAAPARFAPRCWEGIGTILGAMHRYGAERRTACNRATPSRYRADCYRGAAIT*
Ga0164308_1194731223300012985SoilYAGGSEAARLCNLAPARYRGHCFEGVGTILGALHRLGTERRAACNAVTPPRYRGDCYRGAAIT*
Ga0164304_1045277813300012986SoilEASRLCAAAAARFRPRCYEGIGTILGAMHRYGPERRTACNRATPARYRDDCYRGAAIT*
Ga0173483_1015072233300015077SoilCYEGIGTILGSLHRYGDERRAACNGVTPKQYRPDCYRGAAIT*
Ga0173480_1001334713300015200SoilATRLCTAAPARYRARCYEGIGTILGSLHRSGAERRAACDAVTPKAYRRDCYRGAAVS*
Ga0184620_1008063413300018051Groundwater SedimentRYRGRCFEGVGTILGALHRLGRERKAACDAVTPRRYRRDCYRGAAIT
Ga0184621_1025919623300018054Groundwater SedimentCNLAPARDRGHCFEGVGTILGALHRLGSERRAACNAVTPSRYRGDCYRGAAIT
Ga0190269_1003259913300018465SoilSPARYRGRCFEGIGTILGALHRLGSERTAACNAITPKRYRHDCYRGAAIS
Ga0173482_1005770613300019361SoilEATRLCTAAPARYRARCYEGIGTILGSLHRSGAERRAACDAVTPKAYRRDCYRGAAAS
Ga0193720_100996833300019868SoilGTILGALHRLGTARRAACNAVTPSRYRGDCYRGAAIT
Ga0193747_109746723300019885SoilVLCNASPKRYRGYCYEGIGTILGAINRETDARKTACDKVTPKRYRADCYRGAAIT
Ga0193719_1007344743300021344SoilRFAPHCWEGLGTILGAMHRYGAERRAACNKATPDRYRADCYRGAAIT
Ga0222622_1103874213300022756Groundwater SedimentAQFAPRCWEGIGTILGAMHRYGAERRAACNKATPDRFRADCYRGAAIT
Ga0247670_102073913300024283SoilTRLCTASPPAFRGRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT
Ga0247690_100367333300024287SoilCTASPPAFRGRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT
Ga0247678_100192513300024325SoilRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT
Ga0207642_1061752823300025899Miscanthus RhizosphereIGTILGAMHRYGPERRTACNRATPARYRDDCYRGAAIT
Ga0207645_1120178013300025907Miscanthus RhizosphereILGAMHRYGAERRAACDKATPKRYHADCYRGAAIT
Ga0207654_1006238113300025911Corn RhizosphereNYAGTKAATRLCTASPPAFRGRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT
Ga0207663_1096342713300025916Corn, Switchgrass And Miscanthus RhizosphereILGTLHRYGNERKSACKAVTPARYRPDCYRGAAIT
Ga0207701_1099801713300025930Corn, Switchgrass And Miscanthus RhizosphereGRCFEGIGTILGTLHRYGNERKSACKAVTPARYRPDCYRGAAIT
Ga0207690_1145839523300025932Corn RhizosphereRFRARCYEGIGTILGAMHRYGAERRAACDKATPKRYHADCYRGAAIT
Ga0207706_1078877623300025933Corn RhizosphereRLCTAAPARYRERCYEGIGTILGSLHRSGAERRAACDAVTPKAYRRDCYRGAAVS
Ga0207704_1109033923300025938Miscanthus RhizosphereGIGTILGAMHRYGPERRTACNRATPARYRDDCYRGAAIT
Ga0207667_1073213033300025949Corn RhizosphereEGIGTILGAMHRYGPERRTACNRATPARYRDDCYRGAAIT
Ga0207677_1040029613300026023Miscanthus RhizosphereEASRFCAAAAARFRPRCYEGIGTILGAMHRYGQERRTACNRATPARYRDDCYRGAAIT
Ga0207708_1030592213300026075Corn, Switchgrass And Miscanthus RhizospherePARFRARCYEGIGTILGAMHRYGSERRAACNKATPSRYHADCYRGAAIT
Ga0207675_10011231713300026118Switchgrass RhizosphereGREATRLCTAAAARYRKRCYEGIGTILGSLHRSGAERRAACDAVTPKAYRRDCYRGAAVS
Ga0209027_126015613300026300Grasslands SoilRCFEGIGTILGAIHRLGPDRKAACNEVAPARYRADCYRGAAVT
Ga0209468_109536413300026306SoilPRCFEGIGTILGAIHRLGPDRKAACNEVTPARYRADCYRGAAVT
Ga0209178_121719123300027725Agricultural SoilCYEGIGTILGAMHRYGAERRAACNKATPKRYHADCYRGAAIT
Ga0247662_102530613300028293SoilAFRGRCYEGIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT
Ga0307313_1011326323300028715SoilAGGPEASRLCAASPARYRGRCFEGIGTILGALHRLGSERTAACNAITPKRYQPDCYRGAAIS
Ga0307311_1000934113300028716SoilLAPARYRGHCFEGVGTILGALHRLGTARRAACNAVTPSRYRGDCYRGAAIT
Ga0307306_1019437523300028782SoilRYRGHCFEGVGTILGALHRLGTARRAACNAVTPSRYRGDCYRGAAIT
Ga0307290_1003348113300028791SoilGIGTILGTLHRYGNERKSACKAVTPARYRPDCYRGAAIT
Ga0307290_1010480013300028791SoilTILGAIHRDSAGRRNACDAVTPLRYRADCHRGAAVT
Ga0307287_1018533723300028796SoilSRLCAASPARYRGRCFEGIGTILGTLHRLGSERKAACNAVTPKRYQPDCYRGAAIS
Ga0307305_1022121523300028807SoilCAASPARYRGRCFEGIGTILGALHRLGSERTAACNAITPKRYRHDCYRGAAIS
Ga0307302_1016110013300028814SoilLCNLAPAAQRGRCFEGIGTILGTLHRYGNERKSACKAVTPARYRPDCYRGAAIT
Ga0307296_1001716263300028819SoilVEAARLCNLAPAAQRGRCFEGIGTILGTLHRYGNERKSACKAVTPARYRPDCYRGAAIT
Ga0307296_1014641913300028819SoilNLAPARYRGHCFEGVGTILGALHRLGTARRAACNAVTPSRYRGDCYRGAAIT
Ga0307312_1016324313300028828SoilYRGHCFEGVGTILGALHRLGTARRAACNAVTPSRYRGDCYRGAAIT
Ga0307286_1016316313300028876SoilCWEGIGTILGAMHRYGAERRAACDKATPSRYRADCYRGAAIT
Ga0307286_1030321213300028876SoilLAPAAQRGRCFEGIGTILGTLHRYGNERKSACKAVTPARYRPDCYRGAAIT
Ga0307304_1021209613300028885SoilGLCNASPARYRPRCYEGVGTILGALHRFGSERTAACNAVTPKRYRRDCYRGAAIS
Ga0268240_1010744823300030496SoilGTILGSLHRSGAERRAGCDTITPKPYRADCYRGAAVT
Ga0308194_1023996313300031421SoilFEGIGTILGAINRETDARKAACDKVTPKRYRADCYRGAAIT
Ga0308175_10029708313300031938SoilRCYEGIGTILGSLHRYGAERRAACDAITPTAYRADCYRGAAVT
Ga0308174_1123221713300031939SoilPARFRSRCYEGIGTILGAMHRYGPERKAACNRATPARYRADCYRGAAIT
Ga0310906_1007173343300032013SoilIGTILGSLHRYGPQRKAACNTITPAAYRRDCYRGAAVT
Ga0310906_1108214623300032013SoilPRCYEGIGTILGAMHRYGAERKAACKRATPARYRADCYRGAAIA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.