Basic Information | |
---|---|
Family ID | F098981 |
Family Type | Metagenome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | GTAAATIVLEAINATLEKKPIRTIHRRIVPELIVRESTRSVK |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.91 % |
% of genes near scaffold ends (potentially truncated) | 90.29 % |
% of genes from short scaffolds (< 2000 bps) | 82.52 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.136 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.476 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.126 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.835 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF13620 | CarboxypepD_reg | 58.25 |
PF01053 | Cys_Met_Meta_PP | 6.80 |
PF01063 | Aminotran_4 | 1.94 |
PF13551 | HTH_29 | 0.97 |
PF08478 | POTRA_1 | 0.97 |
PF00291 | PALP | 0.97 |
PF13641 | Glyco_tranf_2_3 | 0.97 |
PF04055 | Radical_SAM | 0.97 |
PF12836 | HHH_3 | 0.97 |
PF13377 | Peripla_BP_3 | 0.97 |
PF05977 | MFS_3 | 0.97 |
PF01850 | PIN | 0.97 |
PF00069 | Pkinase | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 6.80 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 6.80 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 6.80 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 6.80 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 6.80 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 6.80 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 6.80 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 6.80 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 6.80 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 6.80 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 6.80 |
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 3.88 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.88 |
COG1589 | Cell division septal protein FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.97 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.97 |
COG4775 | Outer membrane protein assembly factor BamA | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.14 % |
Unclassified | root | N/A | 37.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_104798282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 636 | Open in IMG/M |
3300004091|Ga0062387_101669268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
3300004092|Ga0062389_104604669 | Not Available | 519 | Open in IMG/M |
3300005445|Ga0070708_101003340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 783 | Open in IMG/M |
3300005467|Ga0070706_100072330 | All Organisms → cellular organisms → Bacteria | 3190 | Open in IMG/M |
3300005468|Ga0070707_100338799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1461 | Open in IMG/M |
3300006059|Ga0075017_101112644 | Not Available | 617 | Open in IMG/M |
3300006059|Ga0075017_101480409 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300006102|Ga0075015_100020679 | Not Available | 2909 | Open in IMG/M |
3300006102|Ga0075015_100509390 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300006162|Ga0075030_100551296 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300006797|Ga0066659_10757968 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300007265|Ga0099794_10593121 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009012|Ga0066710_101925729 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300009038|Ga0099829_10908852 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300009038|Ga0099829_11274606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300009088|Ga0099830_11324410 | Not Available | 599 | Open in IMG/M |
3300009632|Ga0116102_1142937 | Not Available | 662 | Open in IMG/M |
3300009640|Ga0116126_1001754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 13286 | Open in IMG/M |
3300009643|Ga0116110_1213921 | Not Available | 623 | Open in IMG/M |
3300009646|Ga0116132_1234452 | Not Available | 558 | Open in IMG/M |
3300009683|Ga0116224_10220789 | Not Available | 906 | Open in IMG/M |
3300009698|Ga0116216_10906442 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300009824|Ga0116219_10073600 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
3300010048|Ga0126373_13151472 | Not Available | 514 | Open in IMG/M |
3300010159|Ga0099796_10308334 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300010339|Ga0074046_10111603 | Not Available | 1760 | Open in IMG/M |
3300010339|Ga0074046_10248277 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300010360|Ga0126372_13034003 | Not Available | 521 | Open in IMG/M |
3300010366|Ga0126379_10748339 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300010398|Ga0126383_11278460 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300012189|Ga0137388_11397480 | Not Available | 639 | Open in IMG/M |
3300012203|Ga0137399_10019610 | All Organisms → cellular organisms → Bacteria | 4392 | Open in IMG/M |
3300012203|Ga0137399_10536488 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300012203|Ga0137399_10870097 | Not Available | 759 | Open in IMG/M |
3300012211|Ga0137377_10588880 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300012285|Ga0137370_10742549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300012349|Ga0137387_11315069 | Not Available | 505 | Open in IMG/M |
3300012683|Ga0137398_10040639 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
3300012918|Ga0137396_10123901 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
3300012922|Ga0137394_11546345 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300012923|Ga0137359_11333975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300012929|Ga0137404_11499267 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300014155|Ga0181524_10465078 | Not Available | 542 | Open in IMG/M |
3300014159|Ga0181530_10204030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
3300014162|Ga0181538_10269963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 932 | Open in IMG/M |
3300014169|Ga0181531_10561577 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300014169|Ga0181531_11080792 | Not Available | 505 | Open in IMG/M |
3300014492|Ga0182013_10107727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1861 | Open in IMG/M |
3300014498|Ga0182019_10000721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16407 | Open in IMG/M |
3300014498|Ga0182019_10128086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
3300014839|Ga0182027_10701709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
3300014839|Ga0182027_12292322 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300017931|Ga0187877_1388290 | Not Available | 528 | Open in IMG/M |
3300017932|Ga0187814_10277649 | Not Available | 638 | Open in IMG/M |
3300017995|Ga0187816_10400977 | Not Available | 610 | Open in IMG/M |
3300018006|Ga0187804_10430979 | Not Available | 587 | Open in IMG/M |
3300018016|Ga0187880_1305385 | Not Available | 685 | Open in IMG/M |
3300018025|Ga0187885_10019201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3966 | Open in IMG/M |
3300018025|Ga0187885_10045287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2285 | Open in IMG/M |
3300018026|Ga0187857_10281225 | Not Available | 762 | Open in IMG/M |
3300018026|Ga0187857_10305914 | Not Available | 725 | Open in IMG/M |
3300018030|Ga0187869_10131372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
3300018037|Ga0187883_10365799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 738 | Open in IMG/M |
3300018038|Ga0187855_10294327 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300018040|Ga0187862_10013510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6704 | Open in IMG/M |
3300019787|Ga0182031_1274925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2330 | Open in IMG/M |
3300021170|Ga0210400_11125784 | Not Available | 635 | Open in IMG/M |
3300022840|Ga0224549_1028153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 764 | Open in IMG/M |
3300022881|Ga0224545_1005706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2021 | Open in IMG/M |
3300025414|Ga0208935_1024379 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300025507|Ga0208188_1124247 | Not Available | 563 | Open in IMG/M |
3300025576|Ga0208820_1000556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26261 | Open in IMG/M |
3300025910|Ga0207684_11070646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
3300025922|Ga0207646_10305481 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300025922|Ga0207646_11098426 | Not Available | 700 | Open in IMG/M |
3300027565|Ga0209219_1108629 | Not Available | 681 | Open in IMG/M |
3300027583|Ga0209527_1087264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 701 | Open in IMG/M |
3300027591|Ga0209733_1138114 | Not Available | 598 | Open in IMG/M |
3300027610|Ga0209528_1089542 | Not Available | 681 | Open in IMG/M |
3300027651|Ga0209217_1163424 | Not Available | 612 | Open in IMG/M |
3300027652|Ga0209007_1177286 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300027663|Ga0208990_1047019 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300027692|Ga0209530_1020180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2014 | Open in IMG/M |
3300027729|Ga0209248_10123096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 778 | Open in IMG/M |
3300027903|Ga0209488_11019211 | Not Available | 571 | Open in IMG/M |
3300028047|Ga0209526_10262004 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300028047|Ga0209526_10596119 | Not Available | 708 | Open in IMG/M |
3300028743|Ga0302262_10307479 | Not Available | 538 | Open in IMG/M |
3300028806|Ga0302221_10169757 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300028863|Ga0302218_10015132 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
3300029985|Ga0302280_1196293 | Not Available | 708 | Open in IMG/M |
3300029990|Ga0311336_11297141 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300030011|Ga0302270_10048028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2994 | Open in IMG/M |
3300030399|Ga0311353_10839624 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300030706|Ga0310039_10286797 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031446|Ga0170820_10514962 | Not Available | 705 | Open in IMG/M |
3300031525|Ga0302326_10004745 | All Organisms → cellular organisms → Bacteria | 31283 | Open in IMG/M |
3300031754|Ga0307475_10609897 | Not Available | 873 | Open in IMG/M |
3300031962|Ga0307479_11372477 | Not Available | 666 | Open in IMG/M |
3300033402|Ga0326728_10012357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19002 | Open in IMG/M |
3300033545|Ga0316214_1070310 | Not Available | 516 | Open in IMG/M |
3300033977|Ga0314861_0256677 | Not Available | 803 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.48% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.85% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.88% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.88% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.91% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.94% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.94% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.97% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.97% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1047982821 | 3300000364 | Soil | GSAAAAIVIETINAGLEKKPARAIHRKVMPDLIVRESTRSLK* |
Ga0062387_1016692682 | 3300004091 | Bog Forest Soil | MGTTAATIVLEAINAGVEKKPIRTIHRRIVPELIVRESTRSAK* |
Ga0062389_1046046691 | 3300004092 | Bog Forest Soil | RQPMENMGTVAATIVLEAINSEANAVLEKKPRRTIHRRIVPELVVRESTRSLK* |
Ga0070708_1010033402 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVMGTAAATIVLEAINSTLEKKPTRTIHRRLVSELIVRESTRNPK* |
Ga0070706_1000723305 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVMGTAAATIVLEAINSTLEKKPTRTIHRRLVSELIVRESTRNLKSPLQSATTACF |
Ga0070707_1003387992 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EAMGAAAAAIVIETINAGLEKKPARAIHRKVVPDLIVRESTHSLK* |
Ga0075017_1011126442 | 3300006059 | Watersheds | EVMGAAAANIVVEAINGVLEKKSLRPIHRKVAPKLIVRESTRSVT* |
Ga0075017_1014804092 | 3300006059 | Watersheds | PMEAMGTLAATIVLEAISRNASADAAPGKKPPRTLHRRIVPELIVRDSTRSVK* |
Ga0075015_1000206791 | 3300006102 | Watersheds | MGTAAATIVLEAINAPQEKKPIRSIHRRIVPELIVRDSTRRVK* |
Ga0075015_1005093901 | 3300006102 | Watersheds | NIVVEAVNGMLEKKTLRPIHRKLAPELIVRESTRSVK* |
Ga0075030_1005512961 | 3300006162 | Watersheds | MGATAANIVVEAINGMLEKKGVRPIHRRIVPELIVRESTSSVK* |
Ga0066659_107579681 | 3300006797 | Soil | TLVLEAINAGLEKKPTRTIHRRIVPELIVRESTGNVK* |
Ga0099794_105931212 | 3300007265 | Vadose Zone Soil | GAAAAAIVVETINAGLEKKPARAIHRKVVPDLIVRESTHSLK* |
Ga0066710_1019257291 | 3300009012 | Grasslands Soil | MGAAAAAIVVETINAGLEKKSARAIHRKVEPDLIVRESTHSLK |
Ga0099829_109088521 | 3300009038 | Vadose Zone Soil | LVLEAINAGLEKKPIRTIHRRIVPELIVRESTGNVK* |
Ga0099829_112746061 | 3300009038 | Vadose Zone Soil | AMGAAAAAIVIEAINAGLEKKPARAIHRKVVPDLIVRESTHSLK* |
Ga0099830_113244101 | 3300009088 | Vadose Zone Soil | ATIVLEAINATLEKKPTRTIHRRIVPELIVRESTRSVK* |
Ga0116102_11429372 | 3300009632 | Peatland | AATIVLEAINATLEKKPVRTIHRRVVPELIVRDSTSSVK* |
Ga0116126_100175411 | 3300009640 | Peatland | EVMGTAAATIVLDAINATLEKKPAHTIHRQIIPELIVRESTRSVR* |
Ga0116110_12139211 | 3300009643 | Peatland | MEVMGTTAATIVLEAINATLEKKPTPTIHRRIVPELIVRESTRSLK* |
Ga0116132_12344521 | 3300009646 | Peatland | QPMEVMGTAAATIVLEAINATLEKKAIRTIHRRIVPELIVRESTRSVK* |
Ga0116224_102207891 | 3300009683 | Peatlands Soil | RQPMEIMGTAAATIVLEAINAALEKKPTRTIHRRIVPELIVRESTRSVK* |
Ga0116216_109064422 | 3300009698 | Peatlands Soil | ATIVLEAINATLEKKPTRTIHRRIVPELIVRDSTRGVN* |
Ga0116219_100736001 | 3300009824 | Peatlands Soil | TAAATIVLEAINATLEKKPTRTIHRRIVPELIVRESTRSVK* |
Ga0126373_131514721 | 3300010048 | Tropical Forest Soil | RQPMEAMGAAAAGIVVNAINGALEKKPPRAMHRKMAPELIVRESTRSLK* |
Ga0099796_103083341 | 3300010159 | Vadose Zone Soil | AAAIVIETINAGLEKKPARAIHRKVLPDLIVRESTSSLK* |
Ga0074046_101116031 | 3300010339 | Bog Forest Soil | GTAAATIVLEAINATLEKKPIRTIHRRIVPELIVRESTRSVK* |
Ga0074046_102482771 | 3300010339 | Bog Forest Soil | MEVMGTAAATIVLEAINSTLEKKPIRTLHRRIVPELIVRDSTRSVK* |
Ga0126372_130340031 | 3300010360 | Tropical Forest Soil | MGAAAATIVIEAIQGALDKKSPRTIHRRVDPELVVRESTTAV* |
Ga0126379_107483392 | 3300010366 | Tropical Forest Soil | QPMEAMGAAAATIVLEAINGALDKKSPRTIHRRIDPELIVRESTRSVK* |
Ga0126383_112784602 | 3300010398 | Tropical Forest Soil | VDAINAGLEKKAARATHRKVVPDLIVRESTSSLK* |
Ga0137388_113974801 | 3300012189 | Vadose Zone Soil | IMGTAAATIVLEAINATLEKKPTRTIHRRIVPELIVRESTRNVK* |
Ga0137399_100196101 | 3300012203 | Vadose Zone Soil | LEAINAGLEKKPTRTIHRRIVPELIVRESTHNVK* |
Ga0137399_105364881 | 3300012203 | Vadose Zone Soil | LEAINAGLEKKPTRTIHRRIVPELIVRESTRNVK* |
Ga0137399_108700971 | 3300012203 | Vadose Zone Soil | IVLEAINAGLEKKPIRTIHRRIVPELIVRESTRSVK* |
Ga0137377_105888801 | 3300012211 | Vadose Zone Soil | IVIETINAGLEKKPARAIHRKVVPDLIVRESTRSLK* |
Ga0137370_107425491 | 3300012285 | Vadose Zone Soil | RQPMEAMGAAAAAIVVETINAGLEKKPARAMHRKVVADLIVRESTHSLK* |
Ga0137387_113150692 | 3300012349 | Vadose Zone Soil | TVRQPIEVMERAAATLVIAAINAGLEKKSIRTIHRRIVPELIVRESTGNVK* |
Ga0137398_100406391 | 3300012683 | Vadose Zone Soil | MGTAAATIVLEAINANLEKKSAPTIHRKIVPELIVRESTRNVK* |
Ga0137396_101239012 | 3300012918 | Vadose Zone Soil | AAATLVLEAINAGLEKKLVRTIHRRIVPELIVRESTGNVK* |
Ga0137394_115463451 | 3300012922 | Vadose Zone Soil | PMETMGAAAAAIVVETINAGLEKKPARAIHRKVVPDLIVRESTRSLK* |
Ga0137359_113339751 | 3300012923 | Vadose Zone Soil | AIVIETINAGLEKKPARAIHRKVVPDLIVRESTRSLK* |
Ga0137404_114992672 | 3300012929 | Vadose Zone Soil | AAAAIVVETINAGLEKKSARAIHRKVEPDLIVRESTRSLK* |
Ga0181524_104650782 | 3300014155 | Bog | LDAINAGLEKKPARIVHRKIAPELIVRESTRSVK* |
Ga0181530_102040302 | 3300014159 | Bog | EIMGTAAATIVLEAINATLEKKPTRTIHRRIVPELIVRESTRSLK* |
Ga0181538_102699631 | 3300014162 | Bog | RQPMEIMGTAAATIVLEAINATLEKKPTRTIHRRIVPELIVRESTRSLK* |
Ga0181531_105615772 | 3300014169 | Bog | MEVAGTIAATIVLEAINATQEKKPIHTIHRRIVPELIVRDSTRSVK* |
Ga0181531_110807922 | 3300014169 | Bog | VLEAISATLEKKPVRTLHRRLVPELIVRDSTRSVR* |
Ga0182013_101077272 | 3300014492 | Bog | MGTAAATIVLEAIDAHTQSDANATVEKQPVRATHRRIVPELIVRESTRSLK* |
Ga0182019_100007211 | 3300014498 | Fen | TIVLEAINANLEKKPARTIHRRIVPELIVRESTRNVK* |
Ga0182019_101280861 | 3300014498 | Fen | ATIVLEAINATLEKKPTPTIHRRIAPELIVRESTRSVK* |
Ga0182027_107017091 | 3300014839 | Fen | MEMMGTVTATIVLEAINATLEKKPTPTIHRRIAPELIVRESTRSVK* |
Ga0182027_122923221 | 3300014839 | Fen | AAATLVLDAINATLEKKPARAIHRQIAPELIVRESTRSVK* |
Ga0187877_13882901 | 3300017931 | Peatland | TAAATIVLEAIDAHTQSDANATVEKQPVRATHRRIVPELIVRESTRSLK |
Ga0187814_102776492 | 3300017932 | Freshwater Sediment | ATVANIVVGAINGMLEKKSVRPIHRRLAPELIVRESTRSVK |
Ga0187816_104009772 | 3300017995 | Freshwater Sediment | VVEAINGMLEKKTVRPIHRRIVPELIVRESTRSEK |
Ga0187804_104309791 | 3300018006 | Freshwater Sediment | SAAANIVLEAINDSVEKKPFHPVHRRIVPELIVRESTRSVK |
Ga0187880_13053852 | 3300018016 | Peatland | PMEVMGTAAATIVLEAINATLEKKPVRTIHRRVVPELIVRDSTSSVK |
Ga0187885_100192011 | 3300018025 | Peatland | RQPMEVMGTAAATIVLDAINATLEKKPVHTIHRQIVPELIVRESTRSVK |
Ga0187885_100452871 | 3300018025 | Peatland | TAAATIVLEAINATLEKKPIRTIHRRIVPELIVRESTRSVK |
Ga0187857_102812251 | 3300018026 | Peatland | TIVLEAINATLEKKPTPTIHRRIVPELIVRESTRSLK |
Ga0187857_103059141 | 3300018026 | Peatland | GTAAATIVLEAINATLEKKPIRTIHRRIVPELIVRESTRSVK |
Ga0187869_101313721 | 3300018030 | Peatland | EVMGTAAATIVLDAINATLEKKPVHTIHRQIVPELIVRESTRSVK |
Ga0187883_103657992 | 3300018037 | Peatland | RQPMEIMGTAAATLVLEAISATLEKKPVRTLHRRLVPELIVRDSTRSVR |
Ga0187855_102943271 | 3300018038 | Peatland | TAAATIVLEAINATLEKKPIRTIHRRIVPELIVRDSTRSVK |
Ga0187862_100135102 | 3300018040 | Peatland | MEVMGTAAATIVLEAINATLEKKPVRTIHRRIVPELIVRDSTSSVK |
Ga0182031_12749255 | 3300019787 | Bog | MESMGTAAATIVLEAIDAHTQSDANATVEKQPVRATHRRIVPELIVRESTRSLK |
Ga0210400_111257842 | 3300021170 | Soil | MEVMGTAAATLVLEAINAGLEKKLVRTIHRRIVPELIVRESTHNVK |
Ga0224549_10281532 | 3300022840 | Soil | VRQPMEIMGTVAATIVLDAINATLEKKPTPTIHRRIVPELIVRESTRSVK |
Ga0224545_10057063 | 3300022881 | Soil | IVLEAINANASGSESAGKKTVRTIHRRIVPELIVRESTCSVK |
Ga0208935_10243792 | 3300025414 | Peatland | AAATLVLEAINADANANANSSAEKKRVRTVHRIIVPDLIVRESTCSVK |
Ga0208188_11242471 | 3300025507 | Peatland | MEVMGTTAATIVLEAINATLEKKPTPTIHRRIVPELIVRESTRSLK |
Ga0208820_100055622 | 3300025576 | Peatland | AATIVLDAINATLEKKPAHTIHRQIIPELIVRESTRSVR |
Ga0207684_110706461 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GTAAATLVLEAINAGLEKKPTRTIHRRIVPELIVRESTGNVK |
Ga0207646_103054812 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVMGTAAATIVLEAINSTLEKKPTRTIHRRLVSELIVRESTRNPK |
Ga0207646_110984262 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTAAATIVLEAINSTLEKKPTTIHRRLVPELIVRESTRNPPAT |
Ga0209219_11086292 | 3300027565 | Forest Soil | AATLVLEAINAGLEKKPTRTIHRRIVPELIVRESTRNVK |
Ga0209527_10872641 | 3300027583 | Forest Soil | IMGTAAATIVLEAISAGLEKKPTKNIHRRIVPELIVRESTRNVK |
Ga0209733_11381141 | 3300027591 | Forest Soil | AATIVLEAINAGLEKKPIRTTHRRIVPELIVRESTRNVK |
Ga0209528_10895421 | 3300027610 | Forest Soil | TLVLEAINAGLEKKAIRTIHRRIVPELIVRESTGNVK |
Ga0209217_11634242 | 3300027651 | Forest Soil | AAATLVLEAINAGLEKKPIRTIHRRIVPELIVRESTRSVK |
Ga0209007_11772862 | 3300027652 | Forest Soil | RQPMEIMGTAAATIVLEAINSNANANASASAEKKPVRTIHRRIVPELIVRESTCSVK |
Ga0208990_10470191 | 3300027663 | Forest Soil | ATLVLEAINAGLEKKPTRTIHRRIVPELIVRESTRSVK |
Ga0209530_10201801 | 3300027692 | Forest Soil | PMEIMGTAAATIVLEAINSNANANASASAEKKPVRTIHRRIVPELIVRESTCSVK |
Ga0209248_101230961 | 3300027729 | Bog Forest Soil | TVRQPMEAMGTAAATIVLEAINANATLDSKPVRTIHRRIVPELVVRDSTRRVK |
Ga0209488_110192111 | 3300027903 | Vadose Zone Soil | LVLEAINAGLEKKPIRTTHRRIVPELIVRESTGNVK |
Ga0209526_102620041 | 3300028047 | Forest Soil | AAATLVLDAINAGLEKKAIRTIHRRIVPELIVRESTGNVK |
Ga0209526_105961192 | 3300028047 | Forest Soil | VMGTAAATLVLEAINAGLEKKPIHTIHRRIVPELIVRESTRNVK |
Ga0302262_103074792 | 3300028743 | Fen | IVVEAISAGLEKKVPRVVHRKVAPELIVRESTRSLK |
Ga0302221_101697572 | 3300028806 | Palsa | IVLEAISATLEKKPVRTIHRRIVPDLIVRDSTRSVK |
Ga0302218_100151322 | 3300028863 | Palsa | TIVLEAINASFENKAIRTIHRRIVPELIVRESTRSVK |
Ga0302280_11962931 | 3300029985 | Fen | MGTTAATIVLDAISAGLEKRPMRTIHRRIVPELIVRESTRSVK |
Ga0311336_112971411 | 3300029990 | Fen | AAAAIVVETINAGLEKKPARAIHRKLVPDLIVRESTRSLK |
Ga0302270_100480281 | 3300030011 | Bog | ATIVLEAIDAHTQSDANATVEKQPVRATHRRIVPELIVRESTRSLK |
Ga0311353_108396242 | 3300030399 | Palsa | PMEMMGTMAATIVLEAINATLEKKPTRCIHRRVVPELIVRDSTGGVK |
Ga0310039_102867972 | 3300030706 | Peatlands Soil | AAATIVLEAINATLEKKPTRTIHRRIVPELIVRESTRSVK |
Ga0170820_105149621 | 3300031446 | Forest Soil | PMEVMGTAAATLVLEAINAGLEKKPTRTIHRRIVPELIVRESTGNVK |
Ga0302326_1000474522 | 3300031525 | Palsa | MEVAGTIAATIVLEAINATQEKKPIHTIHRRIVPELIVRDSTRSVK |
Ga0307475_106098971 | 3300031754 | Hardwood Forest Soil | RQPMEVMGTAAATLVLEAINAGLEKKSTRTIHRRIVPELIVRESTGNVK |
Ga0307479_113724771 | 3300031962 | Hardwood Forest Soil | QPMEVMGTAAATLVLEAINAGLEKKSTRTIHRRIVPELIVRESTGNVK |
Ga0326728_1001235714 | 3300033402 | Peat Soil | MEVMGTAAATLVFDAINATTEKKPANTIHRQIVPELIVRESTRSVK |
Ga0316214_10703102 | 3300033545 | Roots | VAATIVLEAINAGLEKKPIRTIHRRIVPELIVRESTRNVK |
Ga0314861_0256677_638_778 | 3300033977 | Peatland | MEVMGSAAANIVLEAINAALEKKQFRPIHRRIVPELIVRESTRSVK |
⦗Top⦘ |