 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F098834 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PYVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (11.650 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.272 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.660 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.57% β-sheet: 20.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 37.86 |
| PF12697 | Abhydrolase_6 | 12.62 |
| PF00528 | BPD_transp_1 | 7.77 |
| PF00496 | SBP_bac_5 | 4.85 |
| PF00408 | PGM_PMM_IV | 3.88 |
| PF02163 | Peptidase_M50 | 2.91 |
| PF01425 | Amidase | 2.91 |
| PF01019 | G_glu_transpept | 1.94 |
| PF12847 | Methyltransf_18 | 0.97 |
| PF03972 | MmgE_PrpD | 0.97 |
| PF13570 | PQQ_3 | 0.97 |
| PF13561 | adh_short_C2 | 0.97 |
| PF02880 | PGM_PMM_III | 0.97 |
| PF00571 | CBS | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 4.85 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 4.85 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.91 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.94 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1003291782 | 3300000364 | Soil | DAPYVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKNVRWTGK* |
| F12B_102202751 | 3300000443 | Soil | DAPYVFLYFQQQVYVTRQGYEGFVPIPTFAGVYQSLKAVRWTGK* |
| JGI25389J43894_11012051 | 3300002916 | Grasslands Soil | YVFLYFPQQVYVTRQSYDGFVPIPTFAGVYQSLKAVRWSGK* |
| Ga0055432_102543931 | 3300004022 | Natural And Restored Wetlands | KILMEDAPYVFLYFPQQVYVTRTSYEGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0062594_1024211322 | 3300005093 | Soil | YVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK* |
| Ga0070676_103745541 | 3300005328 | Miscanthus Rhizosphere | FSKILMEDAPYVFLYFQQQVYVTRQSYDGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0066388_1007220154 | 3300005332 | Tropical Forest Soil | DAPYVFLYFPQQVYVAKQGYDGFVPIPTFAGIYQSLRNVTWSGK* |
| Ga0066388_1065852212 | 3300005332 | Tropical Forest Soil | EFSKILMEDAPYVFLYFAQQVYVTRTSYDGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0070673_1021075511 | 3300005364 | Switchgrass Rhizosphere | EFSKILMEDAPYVFLYFPQQVYVTRQSYDGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0066689_108803641 | 3300005447 | Soil | EDAPYVFLYFPQQVYVTRQGYEGFVAIPTFAGVYQSLKAVRWTGK* |
| Ga0070686_1014781312 | 3300005544 | Switchgrass Rhizosphere | EFSKILMEDAPYVFLYFPQQVYVTRQSYDGFVPIPAYGGIYQSMKAVKLTGK* |
| Ga0070695_1002999883 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LMEDAPYVFLYFQQQVYVTRQGYEGFVPIPTYAGVYQSLKAVRWTGK* |
| Ga0066701_106432822 | 3300005552 | Soil | PYVFLYFPQQVYVTRQGYDGFVAIPTFAGIYQSLKAARWTGK* |
| Ga0066661_108058262 | 3300005554 | Soil | FPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK* |
| Ga0066704_107556452 | 3300005557 | Soil | YVFLYFPQQVYVTRAGYEGFVPIPTFAGIYQSLKGVRWTGR* |
| Ga0066698_1000037716 | 3300005558 | Soil | KLLMEDAPYVFLYFQQQVYVTRAGYEGLVPIPTFAGIYQSLKSVRWTGK* |
| Ga0066905_1022280301 | 3300005713 | Tropical Forest Soil | EDAPYVFLCYAQQVYVTRQAYEGFVPIAAFGGIYQSMKAVRWTGR* |
| Ga0068866_103302792 | 3300005718 | Miscanthus Rhizosphere | DAPYVFLYFPQQVYVTKAGYEGFVPIPTFGGIYQSLKAVRWTGK* |
| Ga0068861_1020981452 | 3300005719 | Switchgrass Rhizosphere | YFRQQVYVTRAGYEGFVPIPTFGGIYQSLKAVRWTGK* |
| Ga0066903_1002779664 | 3300005764 | Tropical Forest Soil | LYFPQQVYVTRAGYEGFVPVPTFAGIYQSLKAVRWTGK* |
| Ga0066696_106358942 | 3300006032 | Soil | VFLYFPQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGR* |
| Ga0075431_1017914992 | 3300006847 | Populus Rhizosphere | QQVFVTRQSYDGFVPISAFAGVYQSLRAVRWSGK* |
| Ga0075433_112016242 | 3300006852 | Populus Rhizosphere | YVFLYFPQQVYVTRQTYEGFVPVPAFGGIYQSMKAVRFTGR* |
| Ga0075425_1001395934 | 3300006854 | Populus Rhizosphere | LMEDAPYVFLYFRQQVYVTRAGYEGFVPIPTFAGIYQSLKGVRWTGK* |
| Ga0075434_1009665422 | 3300006871 | Populus Rhizosphere | FSKILMEDAPYVFLYYQQQVYVTRTTYDGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0075429_1011194081 | 3300006880 | Populus Rhizosphere | SKLLMEDAPYVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK* |
| Ga0068865_1009696781 | 3300006881 | Miscanthus Rhizosphere | EDAPYVFLYFPQQVYVTKAGYEGFVPIPTFGGIYQSLKAVRWTGK* |
| Ga0075419_100165715 | 3300006969 | Populus Rhizosphere | VFLYFPQQVYGTRSGYEGFVPIPTFAGIYQSLKSVRWTGK* |
| Ga0075435_1004634053 | 3300007076 | Populus Rhizosphere | RVLMEDAPYVFLYFPQQVYVTRQGYEGFVAIPTFAGIYQSLKAVRWTGK* |
| Ga0099794_106872132 | 3300007265 | Vadose Zone Soil | EDAPYVFLYFPQQVYVTRQSYDGFVPIPTFAGVYQSLKTVRWSGK* |
| Ga0111539_117445341 | 3300009094 | Populus Rhizosphere | PYVFLYFQQQVYVTRQGYEGFVPIPTYAGVYQSLKAVRWTGK* |
| Ga0066709_1007614132 | 3300009137 | Grasslands Soil | MDDVPYVFLYFPQQVYMTRQGYDGFVPIPTYAGIYQSLKSVRWTGK* |
| Ga0099792_105644482 | 3300009143 | Vadose Zone Soil | SKLLMEDAPYVFLYFQQQVYVTRSGYEGFVPIPTFGGIYQSLKSVRWTGK* |
| Ga0111538_125025101 | 3300009156 | Populus Rhizosphere | PYVFLYFPQQVFVTRQSYDGFVPISAFAGVYQSLRAVRWSGK* |
| Ga0075423_106117871 | 3300009162 | Populus Rhizosphere | SKILMEDAPYVFLYFQQQVYVTRQTYEGFVPVPAFGGIYQSMKAVRFTGR* |
| Ga0126380_106804691 | 3300010043 | Tropical Forest Soil | FLYFQQQVYVTRAGYDGFVPIPTFAGIYQSLKNVRWTGK* |
| Ga0126384_117879982 | 3300010046 | Tropical Forest Soil | YFPQQVYVTRQGYEGFVPIPAFGGIYQSMKAVRWTGK* |
| Ga0126384_119720641 | 3300010046 | Tropical Forest Soil | MADAPYVFLYFPQQVYVTRQAYEGFVPIPTYGGIYQSLKAVRWTGK* |
| Ga0126384_121400571 | 3300010046 | Tropical Forest Soil | QQVFVTRQTYDGFAPVPAFGGIYQSMKAVRWTGK* |
| Ga0134088_106962602 | 3300010304 | Grasslands Soil | VFLYFPQQVYVTRAGYEGFVPIPTFAGIYQSLKNVRWTGK* |
| Ga0134065_102532751 | 3300010326 | Grasslands Soil | MEDAPYVFLYFQQQVYVTRAGYERFVPIPTFAGIYQSLKGVRWTGR* |
| Ga0126370_126305042 | 3300010358 | Tropical Forest Soil | FLYFPQQVYVTRQGYDGFVPIPTFAGVYQSLKAVRWTGK* |
| Ga0126376_127152132 | 3300010359 | Tropical Forest Soil | VFLYFPQQVYVTRQAYDGFVPIPTFAGVYQSLKAVRWTGK* |
| Ga0126376_130935212 | 3300010359 | Tropical Forest Soil | FLYFRQQVYVTRAGYEGFVPVPTFAGIYQSLKTVRWTGK* |
| Ga0126372_124848471 | 3300010360 | Tropical Forest Soil | QQVYVTRQTYDGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0126379_105115881 | 3300010366 | Tropical Forest Soil | FSKLLMEDAPYVFLYFQQQVYVTRAGYDGFVPIPTFAGIYQSLKNVRWTGK* |
| Ga0126381_1010983381 | 3300010376 | Tropical Forest Soil | LYFPQQVYVTRQGYEGFVPIPAFGGIYQSMKAVRWTGK* |
| Ga0136847_133551044 | 3300010391 | Freshwater Sediment | YVFLYFPQQVYVTRQGYEGLVPIPTFAGIYQSLKAVRWTGR* |
| Ga0126383_115086942 | 3300010398 | Tropical Forest Soil | YVFLYFPQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGK* |
| Ga0134121_111880303 | 3300010401 | Terrestrial Soil | LMEDAPYVFLYFPQQVYVTRQGYDGFVPVPTFAGVYQSLRAVRWTGK* |
| Ga0134123_103648771 | 3300010403 | Terrestrial Soil | SRVLMEDAPYVFLYFQQQVYVTRQGYEGFVPIPTYAGVYQSLKAVRWTGK* |
| Ga0134123_111566551 | 3300010403 | Terrestrial Soil | QQVYVTRQSYDGFVPIPAYGGIYQSMKAVKLTGK* |
| Ga0137376_110644711 | 3300012208 | Vadose Zone Soil | LLMADAPYVFLYFPQQVYVTRQGYEGFVPIPTYGGIYQSLKSVRWTGR* |
| Ga0137377_100540553 | 3300012211 | Vadose Zone Soil | MEDAPYVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK* |
| Ga0137360_114501331 | 3300012361 | Vadose Zone Soil | QQVYVTRAGYEGFVPIPTFGGIYQSLKAVRWTGK* |
| Ga0134056_10430401 | 3300012397 | Grasslands Soil | RVLMEDAPYVFLYFPQQVYVTRQSYDGFVPIPTFAGVYQSLKAVRWSGK* |
| Ga0134061_13407541 | 3300012399 | Grasslands Soil | LYFPQQVYVTRQSYDGFVPIPTFAGAYQSLKAVRWSGK* |
| Ga0137419_101630962 | 3300012925 | Vadose Zone Soil | MEDAPYVFLYFPQQVYATRSGYEGFVPIPTFAGIYQSLKSVRWTGK* |
| Ga0137404_119518992 | 3300012929 | Vadose Zone Soil | QQQVYVTRAGYEGFVPIPTFAGVYQSLKSVRWTGK* |
| Ga0137410_113734711 | 3300012944 | Vadose Zone Soil | LLMEDAPYVFLYFRQQVYVTRAGYEGFAPIPTFGGIYQSLKAVRWTGK* |
| Ga0126369_121996251 | 3300012971 | Tropical Forest Soil | PYVFLYFPQQVYVTRTSYDGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0163162_128644572 | 3300013306 | Switchgrass Rhizosphere | FQQQVYVTRQGYEGFVPIPTFAGVYQSLKAVRWTGN* |
| Ga0134075_100863392 | 3300014154 | Grasslands Soil | MEDAPYVFLYFPQQVYVTRAGYEGFVPIPTFAGIYQSLKGVRWTGR* |
| Ga0163163_116217652 | 3300014325 | Switchgrass Rhizosphere | PQQVYVTRQSYDGFVPIPAYGGIYQSMKSVKLTGR* |
| Ga0180075_10473622 | 3300015252 | Soil | ADAPYVFLYFPQQVYVTRQGYEGFVPIPTYGGIYQSLKSVRWTGK* |
| Ga0132258_129573631 | 3300015371 | Arabidopsis Rhizosphere | FPQQAYVTRQGYEGFVPIPTYAGVYQSLKAVRWTGK* |
| Ga0132257_1004804212 | 3300015373 | Arabidopsis Rhizosphere | MVDAPYVFLYFPQQVYVTRQAYEGFVPIPTYGGIYQSLKAVRWTGK* |
| Ga0182041_119830342 | 3300016294 | Soil | FSKLLMEDAPYVFLYFPQQVYVTRAGYEGFVPVPTFAGIYQSLKTVRWTGK |
| Ga0182033_114411992 | 3300016319 | Soil | LYFQQQVYVTRQGYEGLVPIPTYGGIYQSLRSVRWTGK |
| Ga0182032_117466851 | 3300016357 | Soil | KLLMEDAPYVFLYFQQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0184608_102019592 | 3300018028 | Groundwater Sediment | FLYFQQQVYVTRQGYEGFVPIPTYAGLYQSLKAVRWTGK |
| Ga0066669_117187311 | 3300018482 | Grasslands Soil | KVLMEDAPYVFLYFPQQVYVTRQGYEGFVAIPTFAGIYQSLKAVRWTGK |
| Ga0066669_117514051 | 3300018482 | Grasslands Soil | EDAPYVFLYFPQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGR |
| Ga0207660_107907302 | 3300025917 | Corn Rhizosphere | MEDAPYVFLYFPQQVYVTRAGYDGFVPIPTFGGIYQSLKAVRWTGK |
| Ga0207660_114352662 | 3300025917 | Corn Rhizosphere | LMEDAPYVFLYFPQQVYVTRQGYEGFVALPTFGGIYQSLKVVRWTGK |
| Ga0207668_102343813 | 3300025972 | Switchgrass Rhizosphere | FSKLLMVDAPYVFLYFPQQVYVTRQAYEGFLPIPTYGGIYQSMKSVKLTGR |
| Ga0207648_106794141 | 3300026089 | Miscanthus Rhizosphere | PYVFLYFPQQVYVTRQSYDGFVPIPAYGGIYQSMKAVKLTGR |
| Ga0207676_108617621 | 3300026095 | Switchgrass Rhizosphere | YVFLYFQQQVYVTRQSYDGFVPIPAYGGIYQSMKSVKLTGR |
| Ga0207675_1025803392 | 3300026118 | Switchgrass Rhizosphere | PYVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0209237_12797232 | 3300026297 | Grasslands Soil | YVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0257177_10182422 | 3300026480 | Soil | LMADAPYVFLYFPQQVYVTRQGYEGFVPIPTYGGIYQSLKSVRWTGR |
| Ga0209376_12373511 | 3300026540 | Soil | LSKLLMEDAPYVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0209388_11979531 | 3300027655 | Vadose Zone Soil | EFSKILMEDAPYVFLYFPQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0209465_105307061 | 3300027874 | Tropical Forest Soil | YPQQVYVTRQGYDGFVPVPTFAGVYQSLRAVRWTGK |
| Ga0268264_122884621 | 3300028381 | Switchgrass Rhizosphere | ILMEDAPYVFLYFPQQVYVTRQSYDGFVPIPAYGGIYQSMKSVKLTGR |
| Ga0307504_104145671 | 3300028792 | Soil | YFPQQVYVTRQGYEGFVAIPTFAGIYQSLKAVRWTGK |
| Ga0307497_103919271 | 3300031226 | Soil | LMEDAPYVFLYFRQQVYVTRAGYEGFVPIPTFAGIYQSLKAVRWTGK |
| Ga0318574_108113151 | 3300031680 | Soil | VFLYFQQQVYVTRPGYDGFVPIPTFAGIYQSLKNVRWTGK |
| Ga0318496_102997231 | 3300031713 | Soil | FLYFQQQVYVTRQGYEGLVPIPTYGGIYQSLRSVRWTGK |
| Ga0307469_116623782 | 3300031720 | Hardwood Forest Soil | GEFSKVLMEDAPYTFLNFQQQVYVTRQGYEGFVPIPTFAGVYQSLKAVRWTGK |
| Ga0307469_122164941 | 3300031720 | Hardwood Forest Soil | VLMEDAPYVFLYFQQQVYVTRQGYEGFVPIPTFAGVYQSLKAVRWTGK |
| Ga0307468_1022195502 | 3300031740 | Hardwood Forest Soil | SKLLMEDAPYVFLYFPQQVYVTRSGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0318554_104148842 | 3300031765 | Soil | LMEDAPYVFLYFQQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0318568_101866281 | 3300031819 | Soil | LMEDAPYVFLYFQQQVYVTRAGYDGFVPIPTFAGIYQSLKNVRWTGK |
| Ga0310907_103322031 | 3300031847 | Soil | EFSRVLMEDAPYAFLYFQQQVYVTRQGYEGFVPIPTFAGVYQSLKAVRWTGK |
| Ga0310891_100333811 | 3300031913 | Soil | QQQVYITRQGYEGFVPIPTFAGVYQSLKAVRWTGK |
| Ga0310913_101347861 | 3300031945 | Soil | PYVFLYFPQQVYVTRAGYEGFVPVPTFAGIYQSLKTVRWTGK |
| Ga0318570_103423291 | 3300032054 | Soil | QQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0318533_113795811 | 3300032059 | Soil | MEDAPYVFLYFQQQVYVTRAGYEGFVPIPTFAGIYQSLKSVRWTGK |
| Ga0307472_1005359801 | 3300032205 | Hardwood Forest Soil | PYVFLYFPQQVYVTRQGYEGFVAIPTFAGVYQSLKAVRWTGK |
| Ga0306920_1014306781 | 3300032261 | Soil | VFLYFQQQVYVTRQGYEGLVPIPTYGGIYQSLRSVRWTGK |
| Ga0316628_1032010141 | 3300033513 | Soil | KLLMEDAPYVFLYFPQQVYVTRDGYQGFSPIPTFGGIYQSLKGVRWTGK |
| Ga0364930_0127386_1_135 | 3300033814 | Sediment | GYAVVFLYFEQQVYATRQGYEGFVPIPTYGGIYQSLKAVRWTGK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |