NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098767

Metagenome / Metatranscriptome Family F098767

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098767
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 98 residues
Representative Sequence QAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQRLARRPYCLGPTVGSDQSESVDSARCKSASMLDVGVGL
Number of Associated Samples 80
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 29.13 %
% of genes near scaffold ends (potentially truncated) 69.90 %
% of genes from short scaffolds (< 2000 bps) 97.09 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(47.573 % of family members)
Environment Ontology (ENVO) Unclassified
(68.932 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(55.340 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.49%    β-sheet: 0.00%    Coil/Unstructured: 75.51%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF04519Bactofilin 76.70
PF03401TctC 0.97
PF13565HTH_32 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 76.70
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_14298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300004633|Ga0066395_10260453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium933Open in IMG/M
3300005332|Ga0066388_100133662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3031Open in IMG/M
3300005332|Ga0066388_106023656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300005713|Ga0066905_101114853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium701Open in IMG/M
3300005764|Ga0066903_101253564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1381Open in IMG/M
3300005764|Ga0066903_102768511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium951Open in IMG/M
3300005764|Ga0066903_105273153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium683Open in IMG/M
3300006954|Ga0079219_11816001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300010047|Ga0126382_12461811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300010048|Ga0126373_12685996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300010359|Ga0126376_11238927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300010398|Ga0126383_13145865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300016294|Ga0182041_10245888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1453Open in IMG/M
3300016294|Ga0182041_11817061All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300016319|Ga0182033_11520450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300016319|Ga0182033_11647435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300016341|Ga0182035_11566447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300016357|Ga0182032_11238209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium643Open in IMG/M
3300016371|Ga0182034_11512795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300016371|Ga0182034_11699978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300016387|Ga0182040_11649091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300016445|Ga0182038_10645166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium918Open in IMG/M
3300018054|Ga0184621_10029896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1734Open in IMG/M
3300018074|Ga0184640_10081150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1388Open in IMG/M
3300019269|Ga0184644_1265044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1073Open in IMG/M
3300019886|Ga0193727_1070060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1085Open in IMG/M
3300020004|Ga0193755_1147335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium717Open in IMG/M
3300021080|Ga0210382_10160779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium965Open in IMG/M
3300021082|Ga0210380_10218080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium863Open in IMG/M
3300022726|Ga0242654_10258954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300028778|Ga0307288_10104392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1035Open in IMG/M
3300028790|Ga0307283_10044850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1036Open in IMG/M
3300030988|Ga0308183_1011286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1375Open in IMG/M
3300031058|Ga0308189_10027526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1407Open in IMG/M
3300031081|Ga0308185_1005754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1215Open in IMG/M
3300031082|Ga0308192_1005684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1352Open in IMG/M
3300031098|Ga0308191_1000631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2012Open in IMG/M
3300031099|Ga0308181_1067887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium714Open in IMG/M
3300031100|Ga0308180_1007301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium911Open in IMG/M
3300031123|Ga0308195_1001963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1880Open in IMG/M
3300031422|Ga0308186_1007527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium893Open in IMG/M
3300031573|Ga0310915_10124760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1760Open in IMG/M
3300031573|Ga0310915_10340411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1062Open in IMG/M
3300031573|Ga0310915_10911547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300031573|Ga0310915_11170400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031668|Ga0318542_10169576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1091Open in IMG/M
3300031679|Ga0318561_10168420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1181Open in IMG/M
3300031680|Ga0318574_10926476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300031719|Ga0306917_11350670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300031736|Ga0318501_10144772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1219Open in IMG/M
3300031747|Ga0318502_10181925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1211Open in IMG/M
3300031763|Ga0318537_10256510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium648Open in IMG/M
3300031764|Ga0318535_10176416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium955Open in IMG/M
3300031769|Ga0318526_10487991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300031770|Ga0318521_10647009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300031771|Ga0318546_10917311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria616Open in IMG/M
3300031777|Ga0318543_10165452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium975Open in IMG/M
3300031778|Ga0318498_10519395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300031781|Ga0318547_10681841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria638Open in IMG/M
3300031792|Ga0318529_10437730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium608Open in IMG/M
3300031794|Ga0318503_10073527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1066Open in IMG/M
3300031796|Ga0318576_10072375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1534Open in IMG/M
3300031805|Ga0318497_10285147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium919Open in IMG/M
3300031821|Ga0318567_10490359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031833|Ga0310917_10102550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1843Open in IMG/M
3300031833|Ga0310917_10658422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium710Open in IMG/M
3300031845|Ga0318511_10430402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300031860|Ga0318495_10152870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1040Open in IMG/M
3300031879|Ga0306919_10515903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium921Open in IMG/M
3300031879|Ga0306919_11203465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300031910|Ga0306923_10476536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1413Open in IMG/M
3300031912|Ga0306921_11108837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium886Open in IMG/M
3300031941|Ga0310912_10365566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1121Open in IMG/M
3300031941|Ga0310912_10566396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium884Open in IMG/M
3300031941|Ga0310912_11131384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300031941|Ga0310912_11141423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300031941|Ga0310912_11315773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300031942|Ga0310916_10503459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1031Open in IMG/M
3300031945|Ga0310913_10468455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium894Open in IMG/M
3300031945|Ga0310913_11187037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300031946|Ga0310910_11176475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium595Open in IMG/M
3300031947|Ga0310909_10096491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2369Open in IMG/M
3300031947|Ga0310909_11193676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria615Open in IMG/M
3300031954|Ga0306926_10773071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1159Open in IMG/M
3300031954|Ga0306926_11043011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium970Open in IMG/M
3300031959|Ga0318530_10402395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300032001|Ga0306922_10772143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1006Open in IMG/M
3300032035|Ga0310911_10178884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1201Open in IMG/M
3300032044|Ga0318558_10355824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria726Open in IMG/M
3300032051|Ga0318532_10072124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1203Open in IMG/M
3300032060|Ga0318505_10360892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300032060|Ga0318505_10454033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria605Open in IMG/M
3300032064|Ga0318510_10035471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1696Open in IMG/M
3300032090|Ga0318518_10092735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1499Open in IMG/M
3300032094|Ga0318540_10164749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1064Open in IMG/M
3300032261|Ga0306920_100631978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1582Open in IMG/M
3300032261|Ga0306920_102009510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300032261|Ga0306920_102380633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium731Open in IMG/M
3300032261|Ga0306920_103875887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300032261|Ga0306920_104160213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300033289|Ga0310914_10183553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1862Open in IMG/M
3300033290|Ga0318519_10173874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1216Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil47.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031098Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031100Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031422Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_023354002199352025SoilMRTSVAGPIAAHMQRQAVLSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0066395_1026045313300004633Tropical Forest SoilVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAARKPYCLGPTVDSDQSEGVDSTRCKSASMLDAGVGL*
Ga0066388_10013366213300005332Tropical Forest SoilRTSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQCLARRPYCLVPTVGSDQSESGKSASMLDVGVGL*
Ga0066388_10602365613300005332Tropical Forest SoilRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAASFREAAFPMASVKEHQSRTETFARRSILCDASASPRLACKPYCLGPTVDSDQSEGVDSTRCKSASMLDVGL*
Ga0066905_10111485323300005713Tropical Forest SoilVARMQRQAILSRHEDTREALAQIGARRGVVARFREVAFPMASVKEHLSQTETFARRSILCDASAPQRLARRPYCLGDSDQSESVDSTRCKSASMLDVGVGL*
Ga0066903_10125356433300005764Tropical Forest SoilRHEDIREALAQIGARSGAAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQRLARTYCLGPTVDSDQSEGLDSTRCKSASMLDVGL*
Ga0066903_10276851123300005764Tropical Forest SoilMRRSMAGAIAAHMQRQAIGSRHEDTREALAQIGARSGVAARFREAAFPMASVKEHQSRTETFAQRSIFCDASASPRLACKPYCLGPTVDSDPSEGVDSTRCKSASMLDVGL*
Ga0066903_10527315333300005764Tropical Forest SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFRGVAFPMASVKEHQSQTETFARRSILCDASARSASRKPYCLGPTVDSDQSEGVDSTRCKSASMLHVGVGL*
Ga0079219_1181600123300006954Agricultural SoilMRTSGAGPIAAHMQRQTILSPQEDTCKALAQIGGRGGMAARFREVGLPPMASVKEHQSRTETFARRSILCDASAPQRLARRPYCLGPTVGSDQSESVDSVRCKSASVLDVGVGL*
Ga0126382_1246181123300010047Tropical Forest SoilMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTERLRDGASASASQRLAGRPYGLGSTVDSDQAEGVDSTRCKSDVGVGL*
Ga0126373_1268599623300010048Tropical Forest SoilMQRQAIGSRHEDTREALAQIGARSGVAARFREVAFATASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL*
Ga0126376_1123892713300010359Tropical Forest SoilGMKVGCGAGETRQAHNRMRTSVVGPIAAHMQSQAILSPHEETREALAQIGARGGVAARFREVAFPMASVKEHQSRTEALARRSILCDGNAPQGVARRPYCLGSTVDSDQSESVDPTRCKSASKLDIGAAL*
Ga0126383_1314586513300010398Tropical Forest SoilMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSIPCDANASQRRARKPYCLGPTVDSDQSVGVDSTRCKSASMLDAGVGL*
Ga0182041_1024588813300016294SoilIAAHMQRQAIGSRHEDTREALAQIGARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0182041_1181706113300016294SoilIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQRLAHKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0182033_1152045013300016319SoilIAAHMQRQAILSRHEDTREALAQIGARGGVAASFREVASPMASVKEHQSRAETFARRSILCDASAPQRLVRRPYCLGSTVGSGQSESVDSARCKSASMLDVGVGL
Ga0182033_1164743513300016319SoilAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILWDASAPQGLAGRPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0182035_1156644723300016341SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGAGGGVAARFRVPMASVKEHQSRTEAFERRSILCDASAPQRLAPRPYCLGPTVDSDQSEGVGSARCKSASMLDVGVGL
Ga0182032_1123820923300016357SoilAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCPGPTVDSDQSEGVGSTRCKSASMLDAGVGL
Ga0182034_1151279513300016371SoilALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILWDASAPQRPARKPYCLGPTVGSDPSEGVDSTRCKLASMLHVGVGL
Ga0182034_1169997823300016371SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGAGGGVAARFRVPMASVKEHQSRTEAFERRSILCDASAPQRLAPRPYCLGPTVDSDQSEGVNSARCKSASMLDVGVGL
Ga0182040_1164909123300016387SoilGVAARFREVAFPMASVKEHQSRTETFARRSILWDASAPQGLAGRPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0182038_1064516613300016445SoilDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQCLARRPYCLGPTVGSDQSESGKSASMLDVGVGL
Ga0184621_1002989633300018054Groundwater SedimentMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARWSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0184640_1008115033300018074Groundwater SedimentMRTSVAGPIAAHMQRQAVLSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPMRLARRPYCLGPAVESDHSESVDSTRCKSASMLDVGVGL
Ga0184644_126504423300019269Groundwater SedimentMSVVEEPHLAEQDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0193727_107006013300019886SoilDTREALAQFGARGGVAASFREVAFPMASVKEHQSRTETFARQSIRCDASAPMRLARRPYCLGPAVESDHSESVDSTRCKSASMLDVGVGL
Ga0193755_114733523300020004SoilMRTSVAGPIAAHMQRQAILSCHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARQSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0210382_1016077923300021080Groundwater SedimentEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPLRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0210380_1021808023300021082Groundwater SedimentREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSISCDASAPLRLARRPYCLGTTVESDHSESVDSTRCKSASMLDVGVGL
Ga0242654_1025895413300022726SoilMRTSVAEPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQRLARRPYCLGPTVGSDQSESVDSARCKSASTLD
Ga0307288_1010439213300028778SoilDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0307283_1004485013300028790SoilVAARFREVAFLMASVKEHQSQTETFARRSIRCDASAPLRLARRPYCLGPAVESDHSESVDSTRCKSASMLDVGVGL
Ga0308183_101128613300030988SoilQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPLRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0308189_1002752623300031058SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSQTETFARRSIRCDASAPLRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0308185_100575433300031081SoilMRTSVAGPIAAHMQRQAILSCHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPMRLARRPYCLGATVESDHSESVDSTRCKSASMLDVGVGL
Ga0308192_100568413300031082SoilQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0308191_100063153300031098SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPLRLARRPYCLGPTVESHHSESVDSTRCKSASMLDVGVGL
Ga0308181_106788723300031099SoilAHMQRQAILSRHENTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPLRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0308180_100730113300031100SoilTSVAGPIAAHMQRQAVLSRHEDTREALAQIGARGGVAARFREVAFPMASVKKHQSRTETFARRSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0308195_100196313300031123SoilVAGPIAAHMQRQAILSRHEDTREALAQISARGGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASAPMRLARRPYCLGPTVESDHSESVDSTRCKSASMLDVGVGL
Ga0308186_100752713300031422SoilGPIAADMQRQAVLSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSQTETFARRSIRCDASAPMRLARRPYCLGATVESDHSESVDSTRCKSASMLDVGVGL
Ga0310915_1012476033300031573SoilMRTSVAGPIAVHMQRQAILSRHEDTREALAQIGAGGGVAARFRVPMASVKEHQSRTEAFERRSILCDASAPQRLAPRPYCLGPTVDSDQSEGVGSARCKSASMLDVGVGL
Ga0310915_1034041123300031573SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSIPCDASASQRLARKPYCLGPTVDSDQSVGVDSTRCKSASMLDAGVGL
Ga0310915_1091154723300031573SoilQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0310915_1117040023300031573SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTKTFARRSILWDASASQRLAGRPYCLGPTVDSDQSESVDSTRCKSASMLDVGVGL
Ga0318542_1016957633300031668SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILWDASAPQRLARRPYCLGPTVDSDQSVGVDSTRCKSASMLDAGVGL
Ga0318561_1016842033300031679SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAASFREVASPMASVKEHQSRAETFARRSILCDASAPQRLVRRPYCLGSTVGSGQSESVDSARCKSASMLDVGVGL
Ga0318574_1092647623300031680SoilTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0306917_1135067013300031719SoilIAAHMQRQAILSRHEDTREALAQIGAGGGVAARFRVPMASVKEHQSRTEAFERRSILCDASAPQRLAPRPYCLGPTVDSDQSEGVDSARCKSASMLDVGVGL
Ga0318501_1014477233300031736SoilVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0318502_1018192513300031747SoilARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0318537_1025651023300031763SoilFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0318535_1017641623300031764SoilEALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLDVGVGL
Ga0318526_1048799113300031769SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSIPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL
Ga0318521_1064700923300031770SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGAGGGVAARFRVPMASVKEHQSRTEAFERRSILCDASAPQRLARRPYCLGPTVDSDQSEGVDSARCKSASMLDVGVGL
Ga0318546_1091731113300031771SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLDAGVGL
Ga0318543_1016545213300031777SoilSGVAARFREVAFPMASVKEHQSRTETFARRSIPCDASASQRLARKPYCLGPTVDSDQSVGVDSTRCKSASMLDAGVGL
Ga0318498_1051939513300031778SoilALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0318547_1068184113300031781SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILWDASAPQGLAGRPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0318529_1043773023300031792SoilAQIGVRSGVVARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLHVGVGL
Ga0318503_1007352713300031794SoilILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTEAFERRRILCDASAPQRLARRPYCLGPTVDSDQSEGVDSARCKSASMLDVGVGL
Ga0318576_1007237543300031796SoilEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARGSILCDASAPQRLARRPYCLGPTVDSDQSESVGRLAANPS
Ga0318497_1028514723300031805SoilAFPIALVKEHQSRTETFARRSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLHVGVGL
Ga0318567_1049035923300031821SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0310917_1010255013300031833SoilEVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0310917_1065842223300031833SoilMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQCLARRPYCLGPTVGSDQSESGKSASMLDVGVGL
Ga0318511_1043040223300031845SoilAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQRPARKPYCLGPTVGSDPSEGVDSTRCKLASMLHVGVGL
Ga0318495_1015287023300031860SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRSKSASMLDAGVGL
Ga0306919_1051590323300031879SoilMRTSVARPIAAHMQRQAIGSRHEDTREALAQIGARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0306919_1120346523300031879SoilMRTSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILWDASAPQGLAGRPYCLGPTVDSDPS
Ga0306923_1047653633300031910SoilSVAGPIAAYMQCQAILSRHEDTREALAQIGVRSGVAARFREVAFPIASVKEHQSRTETFARRSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLHVGVGL
Ga0306921_1110883713300031912SoilAAYMQRQAILSRHEDTREALAQIGARSGVAARFREAAFPMASVKEHQSRTETFARRSLPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL
Ga0310912_1036556623300031941SoilMRTSVAGPIAAYMQCQAILSRHEDTREALAQIGVRSGVAARFREVAFPIASVKEHQSRTETFARRSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLHVGVGL
Ga0310912_1056639623300031941SoilGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0310912_1113138413300031941SoilAHNRMRTSVAGPIAAHMQRQAILSRHEDTREALAQIGAGGGVAARFRVPMASVKEHQSRTEAFERRSILCDASAPQRLAPRPYCLGPTVDSDQSEGVGSARCKSASMLDVGVGL
Ga0310912_1114142323300031941SoilQAIGSRHEDTREALAQIGARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGSTVDSDPSEGVDSTRCKLASMLHVGMGL
Ga0310912_1131577323300031941SoilIGARSGVAARFREVAFPMASVKEHQSRTETFARRSLPCDASASPRLARKPYCLGPTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0310916_1050345913300031942SoilREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSLPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL
Ga0310913_1046845523300031945SoilHEDTREALAQIGARSGVAARFREAAFPMASVKEHQSRTETFARRSLPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL
Ga0310913_1118703723300031945SoilMRTSVAGPIAAHMQRQAIGSRHEDTREALAQIGARSGVAARFREVAFPMASVKEHQSRRKTFARRSILCDARAPQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLDVGVGL
Ga0310910_1117647513300031946SoilSRHEDTREALAQIGARSGVAARFREVAFPMASAKEHQSRTETFARRSIRCDASASPRLARKPYCLGPTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0310909_1009649153300031947SoilLSRHEDTREALAQIGARSGVAARFREAAFPMASVKEHQSRTETFARRSLPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL
Ga0310909_1119367623300031947SoilMRTSVAGPIAAYMQCQAILSRHEDTREALAQIGVRSGVAARFREVAFPIASVKEHQSRTETFARRSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLHVGVG
Ga0306926_1077307113300031954SoilREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0306926_1104301123300031954SoilRPIAAHMQRQAIGSRHEDTREALAQIGARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0318530_1040239523300031959SoilMRTSVAGPIAAYMQRQAILSCHEDTREALAQIGARSGVAARFREVAFPMALVKEHQSRTETFARRSILCDASASQRLARKPYCPGPTVDSDQS
Ga0306922_1077214313300032001SoilRSGVAARFREVAFPMASVKEHQSRTETFARRSILCAASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLDAGVGL
Ga0310911_1017888413300032035SoilIGVRSGVVARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0318558_1035582423300032044SoilMRTSVAGPIAAYMQCQAILSRHEDTREALAQIGVRSGVAARFREVAFPIASVKEHQSRTERSILCDASASQRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLHVGVGL
Ga0318532_1007212413300032051SoilAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSLPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL
Ga0318505_1036089223300032060SoilRVPMASVKEHQSRTEAFERRSILCDASAPQRLAPRPYCLGPTVDSDQSEGVDSARCKSASMLDVGVGL
Ga0318505_1045403313300032060SoilMRTSVAGPIAAYMQRQAILSCHEDTREALAQIGARSRVAARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0318510_1003547113300032064SoilEALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSIPCDASASQRLARKPYCLGPTVDSDQSVGVDSTRCKSASMLDAGVGL
Ga0318518_1009273513300032090SoilAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARGSILCDASAPQRLARRPYCLGPTVDSDQSESVGRLAANPS
Ga0318540_1016474913300032094SoilALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSIRCDASASPRLARKPYCLGPTVDSDPSEGVDSTRCKSASMLHAGVGL
Ga0306920_10063197833300032261SoilSVAGPIAAHMQRQAILSRHEDTREALAQIGARGGVAASFREVASPMASVKEHQSRAETFARRSILCDASAPQRLVRRPYCLGSTVGSGQSESVDSARCKSASMLDVGVGL
Ga0306920_10200951013300032261SoilTREALAQIGARSGVAARFREVAFPMASVKEHQSRTETFARRSLPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL
Ga0306920_10238063313300032261SoilALAQIGAGGGVAARFRVPMASVKEHQSRTEAFERRSILCDASAPQRLAPRPYCLGPTVDSDQSEGVGSARCKSASMLDVGVGL
Ga0306920_10387588723300032261SoilMQRQAILSRHEDTREALAQIGARSGVAARFREVAFAMASVKEHQSQKETFARWSILCDASAPQRLARKPYCLGPTVDSDPSEGVDSTRCKLASMLHVGVGL
Ga0306920_10416021313300032261SoilQAILSRHEDTREALAQIGARGGVAARFREVAFPMASVKEHQSRTETFARRSILCDASAPQRLARRPYCLGPTVGSDQSESVDSARCKSASMLDVGVGL
Ga0310914_1018355313300033289SoilVVARFREVAFPMASVKEHQSRTETFARRSILCDASASQRLARKPYCLGRTVDSDQSEGVDSTRCKSASMLDAGVGL
Ga0318519_1017387433300033290SoilSVAGPIAAYMQRQAILSRHEDTREALAQIGARSGVAARFREAAFPMASVKEHQSRTETFARRSLPCDASASQGLARKPYCLGPTVDSDPSVGVDSTRCKSASMLDAGVGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.