NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098734

Metagenome / Metatranscriptome Family F098734

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098734
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 46 residues
Representative Sequence MKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKARPGKR
Number of Associated Samples 90
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.64 %
% of genes near scaffold ends (potentially truncated) 30.10 %
% of genes from short scaffolds (< 2000 bps) 83.50 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.117 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.447 % of family members)
Environment Ontology (ENVO) Unclassified
(40.777 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(34.951 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 46.67%    β-sheet: 0.00%    Coil/Unstructured: 53.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF07883Cupin_2 24.27
PF16326ABC_tran_CTD 23.30
PF14833NAD_binding_11 6.80
PF08240ADH_N 1.94
PF01177Asp_Glu_race 0.97
PF04909Amidohydro_2 0.97
PF04185Phosphoesterase 0.97
PF07676PD40 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.12 %
UnclassifiedrootN/A3.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000574|JGI1357J11328_10195327All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300003994|Ga0055435_10070800All Organisms → cellular organisms → Bacteria → Proteobacteria878Open in IMG/M
3300004156|Ga0062589_100103058All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300004156|Ga0062589_102323458Not Available551Open in IMG/M
3300004463|Ga0063356_101298590All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300005218|Ga0068996_10065566All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005295|Ga0065707_10874519All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005345|Ga0070692_10562149All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005440|Ga0070705_100374642All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300005468|Ga0070707_101173083All Organisms → cellular organisms → Bacteria → Proteobacteria734Open in IMG/M
3300005468|Ga0070707_101184673All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005530|Ga0070679_101779575All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005546|Ga0070696_100404975All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300005617|Ga0068859_102667580All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005833|Ga0074472_10620843All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300007255|Ga0099791_10260695All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300007255|Ga0099791_10656019All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300007265|Ga0099794_10283140All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300009823|Ga0105078_1054150All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010391|Ga0136847_11814901All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300011410|Ga0137440_1032242All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300011423|Ga0137436_1123393All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300011424|Ga0137439_1039713All Organisms → cellular organisms → Bacteria → Proteobacteria870Open in IMG/M
3300011429|Ga0137455_1038925All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300011429|Ga0137455_1191794All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300011436|Ga0137458_1070054All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300012096|Ga0137389_11135801All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300012203|Ga0137399_10486182All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300012355|Ga0137369_10765296All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012358|Ga0137368_10964811All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012925|Ga0137419_10073172All Organisms → cellular organisms → Bacteria2291Open in IMG/M
3300012925|Ga0137419_11114544All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012929|Ga0137404_10078980All Organisms → cellular organisms → Bacteria2604Open in IMG/M
3300012930|Ga0137407_10199393All Organisms → cellular organisms → Bacteria1794Open in IMG/M
3300014326|Ga0157380_11071358All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300014873|Ga0180066_1001335All Organisms → cellular organisms → Bacteria3137Open in IMG/M
3300014877|Ga0180074_1030442All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300014885|Ga0180063_1009657All Organisms → cellular organisms → Bacteria2578Open in IMG/M
3300015259|Ga0180085_1261130All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300018000|Ga0184604_10004350All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300018052|Ga0184638_1169671All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300018053|Ga0184626_10005467All Organisms → cellular organisms → Bacteria4816Open in IMG/M
3300018054|Ga0184621_10037792All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300018059|Ga0184615_10131389All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300018074|Ga0184640_10051318All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300018077|Ga0184633_10570966All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300018422|Ga0190265_10022079All Organisms → cellular organisms → Bacteria5104Open in IMG/M
3300018422|Ga0190265_10027482All Organisms → cellular organisms → Bacteria → Proteobacteria4664Open in IMG/M
3300018429|Ga0190272_10150134All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300018465|Ga0190269_11700051All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300019360|Ga0187894_10021295All Organisms → cellular organisms → Bacteria4559Open in IMG/M
3300019377|Ga0190264_11556848All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300019458|Ga0187892_10062131All Organisms → cellular organisms → Bacteria2456Open in IMG/M
3300019458|Ga0187892_10173395All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300019872|Ga0193754_1004571All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300019881|Ga0193707_1067897All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300019882|Ga0193713_1002497All Organisms → cellular organisms → Bacteria6013Open in IMG/M
3300019883|Ga0193725_1077402All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300019883|Ga0193725_1086010All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300019886|Ga0193727_1048016All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300019886|Ga0193727_1078625All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300020002|Ga0193730_1151194All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300020060|Ga0193717_1117426All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300020063|Ga0180118_1233975All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300022756|Ga0222622_10533275All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300024330|Ga0137417_1093520All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300025324|Ga0209640_10006390All Organisms → cellular organisms → Bacteria10321Open in IMG/M
3300025324|Ga0209640_10084073All Organisms → cellular organisms → Bacteria → Proteobacteria2749Open in IMG/M
3300025521|Ga0210083_1056505All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025885|Ga0207653_10075822Not Available1156Open in IMG/M
3300025912|Ga0207707_10728585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae831Open in IMG/M
3300025922|Ga0207646_10893084All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300025922|Ga0207646_11485158All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300025934|Ga0207686_10356190All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300025955|Ga0210071_1005596All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300026047|Ga0208658_1021635Not Available534Open in IMG/M
3300026054|Ga0208659_1009130All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300026320|Ga0209131_1003264All Organisms → cellular organisms → Bacteria10803Open in IMG/M
3300026360|Ga0257173_1003004All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300026499|Ga0257181_1002198All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300026507|Ga0257165_1049360All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300026535|Ga0256867_10033738All Organisms → cellular organisms → Bacteria → Proteobacteria2133Open in IMG/M
3300027395|Ga0209996_1009271All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300027815|Ga0209726_10184164All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300027979|Ga0209705_10542446All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300028380|Ga0268265_10112435All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300028673|Ga0257175_1018085All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300028803|Ga0307281_10069236All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300030006|Ga0299907_10272675All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300030620|Ga0302046_10299700All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300030990|Ga0308178_1105760All Organisms → cellular organisms → Bacteria603Open in IMG/M
(restricted) 3300031150|Ga0255311_1035527All Organisms → cellular organisms → Bacteria1041Open in IMG/M
(restricted) 3300031150|Ga0255311_1038037All Organisms → cellular organisms → Bacteria1008Open in IMG/M
(restricted) 3300031150|Ga0255311_1040708All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300031229|Ga0299913_10249238All Organisms → cellular organisms → Bacteria1759Open in IMG/M
(restricted) 3300031248|Ga0255312_1028415All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300031720|Ga0307469_10028387All Organisms → cellular organisms → Bacteria3201Open in IMG/M
3300031740|Ga0307468_101367807Not Available649Open in IMG/M
3300031949|Ga0214473_10343285All Organisms → cellular organisms → Bacteria1696Open in IMG/M
3300032174|Ga0307470_10096915All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1677Open in IMG/M
3300032180|Ga0307471_100714400All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1167Open in IMG/M
3300033233|Ga0334722_10483301All Organisms → cellular organisms → Bacteria → Proteobacteria890Open in IMG/M
3300034165|Ga0364942_0303907All Organisms → cellular organisms → Bacteria522Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.77%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.88%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil3.88%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.94%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.94%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.97%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.97%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.97%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.97%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025521Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025955Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026047Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd (SPAdes)EnvironmentalOpen in IMG/M
3300026054Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027395Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI1357J11328_1019532723300000574GroundwaterMKKKPAGVFSLIASGLTGFGAHLVTLCATARDRLLALQSGKARSGKR*
Ga0055435_1007080033300003994Natural And Restored WetlandsMKKKPPGVFSLLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR*
Ga0062589_10010305853300004156SoilMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR*
Ga0062589_10232345823300004156SoilMVKKQPGVLSLIVTAFTGFGTHLVALCVTGRDRLLALPGRKGRSGKR*
Ga0063356_10129859023300004463Arabidopsis Thaliana RhizosphereMKKKSPGVLSLIVTAFTGFGAHIVALCVTGRDRLLALQGRKVRHGKR*
Ga0068996_1006556623300005218Natural And Restored WetlandsMKKKPPGVFSLIVTAFTGFGSHIMTLCVTGRDRLLALQGRKARNGKR*
Ga0065707_1087451923300005295Switchgrass RhizosphereMKKKPPGVFSLIVTAFTGFGVHLVALCATGRDRLLALQGRKARPGKR*
Ga0070692_1056214933300005345Corn, Switchgrass And Miscanthus RhizosphereVSRPVSKGAPMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR*
Ga0070705_10037464243300005440Corn, Switchgrass And Miscanthus RhizosphereMKKQPGVFSLIVTAFTGFGAHIVSLCVTGRDRLLALPGRKKQTGKR*
Ga0070707_10117308333300005468Corn, Switchgrass And Miscanthus RhizosphereMKKPPGVLSLIVTAFTGFGAHIVALCVSGRDRLLAHPGRKARNGKR*
Ga0070707_10118467313300005468Corn, Switchgrass And Miscanthus RhizosphereMKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR*
Ga0070679_10177957513300005530Corn RhizosphereMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALQGRKTRPGKR*
Ga0070696_10040497513300005546Corn, Switchgrass And Miscanthus RhizosphereMKKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR*
Ga0068859_10266758013300005617Switchgrass RhizospherePVSRPVSKGAPMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR*
Ga0074472_1062084323300005833Sediment (Intertidal)MKKPPGAFSLIVTAFTGFGAHIVALCVTGRDRLLALQSRKVRPGKR*
Ga0099791_1026069523300007255Vadose Zone SoilMKKKPAGVFSLIVTAFTGFGAHLLALCATGRDRLLALQSRKARPGKR*
Ga0099791_1065601933300007255Vadose Zone SoilGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR*
Ga0099794_1028314023300007265Vadose Zone SoilMKKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR*
Ga0105078_105415013300009823Groundwater SandPMKKKQPGVFSLIATAFTGFGAHLVTLCGTARDRLLALQGRKARPGKR*
Ga0136847_1181490123300010391Freshwater SedimentMKKKPPGVLSLIVTAFTGFGAHIVALCVTGRDRLLALQGRKVRPGKR*
Ga0137440_103224233300011410SoilMKKKPPGVFSLIVTAFTGFGAHIVALCVTGRDRLLAFQGRKARPGKR*
Ga0137436_112339333300011423SoilMKKKSPGVFSLIATGFTGFGAHLVSLCAAARDRLLALQSRKARSGKR*
Ga0137439_103971333300011424SoilMKKKSPGVFSLIVTGFTGFGAHLVSLCATARDRLLALQ
Ga0137455_103892533300011429SoilMKKKPPGVFSLIATGFTGFGAHLVTLCAAARDRLLALQ
Ga0137455_119179423300011429SoilLEGSPMKKKSRRVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR*
Ga0137458_107005423300011436SoilMKKKPPGVFSLIVTAFTGFGAHIVALCVTGRDRLLAFQGRKARHGKR*
Ga0137389_1113580113300012096Vadose Zone SoilIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR*
Ga0137399_1048618223300012203Vadose Zone SoilMKKPPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR*
Ga0137369_1076529623300012355Vadose Zone SoilMKKPSGVFSLIVTAFTGFGARIVTLCGTARDRLLALQGRKARPRKR*
Ga0137368_1096481123300012358Vadose Zone SoilMKKPSGVFSLIVTAFTGFGAHIVTLCGTARDRLLALQGRKARPRKR*
Ga0137419_1007317253300012925Vadose Zone SoilMKKPPGVFSLIATAFTGFGAHMVTLCGTARDRLLALQGRKARPGKR*
Ga0137419_1111454423300012925Vadose Zone SoilMKKKPAGVFSLIVTAFSGFGAHLLALCATGRDRLLALQSRKARPGKR*
Ga0137404_1007898023300012929Vadose Zone SoilMKKKQPGVFSLIATAFTGFGAHIATLCGTARDRLLALQGRKARPGKR*
Ga0137407_1019939323300012930Vadose Zone SoilMKKKQPGVFSLTATAFTGFGAHIATLCGTARDRLLALQGRKARPGKR*
Ga0157380_1107135823300014326Switchgrass RhizosphereMKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKTRPGKR*
Ga0180066_100133553300014873SoilMKKKPPGVFSLIATGFTGFGAHLVTLCATARDRLLALQSRKARSGKR*
Ga0180074_103044233300014877SoilMKKKPPGVLSLIVTAFTGFGAHLVALCVTGRDRLLALQGRKVRHGKR*
Ga0180063_100965733300014885SoilMKKKSPGVFSLIATGVTGFGAHLVTLCATARDRLLALQSRKARSGKR*
Ga0180085_126113013300015259SoilKSPGVFSLIATGVTGFGAHLVTLCATARDRLLALQSRKARSGKR*
Ga0184604_1000435033300018000Groundwater SedimentMKKPPGVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR
Ga0184638_116967133300018052Groundwater SedimentMKKKLPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSG
Ga0184626_1000546733300018053Groundwater SedimentMKKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR
Ga0184621_1003779243300018054Groundwater SedimentMKKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR
Ga0184615_1013138933300018059Groundwater SedimentMKKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQGRKARSGKR
Ga0184640_1005131843300018074Groundwater SedimentMKKKPPGVFSLIATGFTGFGAHLVTLCAAARDRLLALQSRKVRSGKR
Ga0184633_1057096633300018077Groundwater SedimentFSLIATGFTGFGAHLVSLCATARDRLLALQSRKVRSGKR
Ga0190265_1002207953300018422SoilMKKKSPGVFSLIVTAFSGFGVHILSLCVTGRDRLLALQGRKARPGKR
Ga0190265_1002748233300018422SoilMKKKPPGVFSLIVTAFTGLGAHLVALCVTGRDRVLAFQGRKARPGKR
Ga0190272_1015013433300018429SoilMKKKQPGVFSLIVTAFTGFGAHVVALCLTGRDRLRALQGRKVRQHGKR
Ga0190269_1170005113300018465SoilMKKKQPGVFSLIATAFTGFGAHIATLCGTARDRLLALQGRKARPGKR
Ga0187894_1002129523300019360Microbial Mat On RocksMKKKSPGVFSLLVAGFSGFGAHLVTVCATARDRLLALQSRKARSRKR
Ga0190264_1155684813300019377SoilGVFSLLVAGFSGFGAHLVTLCATARDRLLALQSRKARSGKR
Ga0187892_1006213123300019458Bio-OozeMKKKSPGVFSLLVAGFSGFGAHLVTLCATARDRLLALQSRKARSRKR
Ga0187892_1017339543300019458Bio-OozeMKKKPPGVFSLLVAGFSGFGAHLVTVCATARDRLLALQSRKARSRKR
Ga0193754_100457133300019872SoilMKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKARPGKR
Ga0193707_106789713300019881SoilVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR
Ga0193713_100249763300019882SoilMKKKPPGVFSLIATAFSGFGAHLVALCATGRDRLLALQGRKARPGKR
Ga0193725_107740223300019883SoilMKKKLPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR
Ga0193725_108601023300019883SoilMKKPAGVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR
Ga0193727_104801613300019886SoilFALIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR
Ga0193727_107862513300019886SoilPMKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKARPGKR
Ga0193730_115119413300020002SoilASRLEGSPMKKPPGVFSLIATAFTGFGAHLVTLCGTARDRLLALQGRKARPGKR
Ga0193717_111742623300020060SoilMKRKQPGVFSLIVTVFTGFGAHVVALCLSGRDRLLALQGRKVRHGKR
Ga0180118_123397513300020063Groundwater SedimentMKKKSPGVFSLIATGFTGFGAHLVSLCATARNRLLALQSRKARSGKR
Ga0222622_1053327533300022756Groundwater SedimentGVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR
Ga0137417_109352033300024330Vadose Zone SoilMKKPPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR
Ga0209640_1000639053300025324SoilMKKPPGVFSLMAAALTGFGAHLVNLCSTARARLLALQSRKARPGKR
Ga0209640_1008407323300025324SoilMKKKSPGVFSLIATGVTGFGAHLVTLCATARDRLLALQSRKARSGKR
Ga0210083_105650523300025521Natural And Restored WetlandsVSSHLEGSPMKKKPPGVFSLLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR
Ga0207653_1007582213300025885Corn, Switchgrass And Miscanthus RhizosphereMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR
Ga0207707_1072858533300025912Corn RhizosphereMVKKQPGVLSLIVTAFTGFGTHLVALCVTGRDRLLALPGRKGRSGKR
Ga0207646_1089308423300025922Corn, Switchgrass And Miscanthus RhizosphereMKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR
Ga0207646_1148515813300025922Corn, Switchgrass And Miscanthus RhizosphereMKKPPGVLSLIVTAFTGFGAHIVALCVSGRDRLLAHPGRKARNGK
Ga0207686_1035619033300025934Miscanthus RhizosphereMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQG
Ga0210071_100559633300025955Natural And Restored WetlandsMKKKPPGVFSLLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR
Ga0208658_102163513300026047Natural And Restored WetlandsMKKKPPGVFSLIVTAFTGFGSHIMTLCVTGRDRLLAL
Ga0208659_100913013300026054Natural And Restored WetlandsLLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR
Ga0209131_100326463300026320Grasslands SoilMKKKPAGVFSLIVTAFSGFGAHLLALCATGRDRLLALQSRKARPGKR
Ga0257173_100300413300026360SoilLEGSPMKKKSPRVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR
Ga0257181_100219823300026499SoilMKKKSPGVFSLIATGFTGFGAHLVSMCATARDRLLALQSRKARSGKR
Ga0257165_104936023300026507SoilKKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR
Ga0256867_1003373853300026535SoilMKKKPPGVFSLLATGVTGFGAHLVTLCATARDRLLALQSRKVRPGKR
Ga0209996_100927113300027395Arabidopsis Thaliana RhizosphereMAKPPGVFSLLVTAVTGFGNHLVGLCAAGRDRLLGR
Ga0209726_1018416423300027815GroundwaterMKKKPAGVFSLIASGLTGFGAHLVTLCATARDRLLALQSGKARSGKR
Ga0209705_1054244613300027979Freshwater SedimentMKKKPPGVFSLIVTAFTGFGAHIVALCVTGRDRLLALQGRKVRHGKR
Ga0268265_1011243513300028380Switchgrass RhizosphereMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALQGRKTRPGKR
Ga0257175_101808513300028673SoilVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR
Ga0307281_1006923633300028803SoilMKKKPPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR
Ga0299907_1027267533300030006SoilMKKKPPGVFSLLTTGVTGFGAHLVTLCATARDRLLALQSRKVRPGKR
Ga0302046_1029970053300030620SoilMSRLEGSPMKKKSPGVFSLIAAGFTGFGAHLVSLCATARDRLLALQSRKARSGKR
Ga0308178_110576023300030990SoilMKKKQPGVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR
(restricted) Ga0255311_103552713300031150Sandy SoilMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLL
(restricted) Ga0255311_103803733300031150Sandy SoilMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALPGRKARPGKR
(restricted) Ga0255311_104070823300031150Sandy SoilMKKKPPGVFSLIVTAFTGFGAHLVTLCVTGRDRLLTLQSRKIRPGKR
Ga0299913_1024923853300031229SoilMKKKLPGVFSLLATGVTGFGAHLVTLCATARDRLLALQGRKVRPGKR
(restricted) Ga0255312_102841513300031248Sandy SoilMKKKPPGVFSLIVTAFTGFGAHLVTLCVTGRDRLLTLQSRKIRP
Ga0307469_1002838753300031720Hardwood Forest SoilMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALQGRKARPGKR
Ga0307468_10136780723300031740Hardwood Forest SoilTSRLEGSPMKKKPPGVFSLIVTAFTGFGAHIVSLCVTGRDRLLALQGRKARHGKR
Ga0214473_1034328553300031949SoilMKKKSPGVFSLIVAGFSGFGAHLVTLCATARDRLLALQSRKVRSRKR
Ga0307470_1009691523300032174Hardwood Forest SoilMKKKQPGVFSLIVTAFTGFGAHIVSLCVTGRDRLLALQGRKARHGKR
Ga0307471_10071440023300032180Hardwood Forest SoilMKKQPGVFSLIVTAFTGFGAHIVSLCATGRDRLLALPGRKKQTGKR
Ga0334722_1048330133300033233SedimentMKKKPPGVFSLIVTAFTGFGAHIMALCVTGRDRLLALQNRKVRPGKR
Ga0364942_0303907_2_1213300034165SedimentFSLIATGFTGFGAHLVTLCAAARDRLLALQSRKARSGKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.