Basic Information | |
---|---|
Family ID | F098298 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | PVYAFSANNGANGCVDCQGGNNGKITGLEGGTTMRQLQFAIRFDF |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.88 % |
% of genes near scaffold ends (potentially truncated) | 98.08 % |
% of genes from short scaffolds (< 2000 bps) | 87.50 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.16 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.115 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.038 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.962 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.74% Coil/Unstructured: 97.26% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF14559 | TPR_19 | 25.96 |
PF13432 | TPR_16 | 24.04 |
PF00294 | PfkB | 5.77 |
PF04041 | Glyco_hydro_130 | 4.81 |
PF01204 | Trehalase | 2.88 |
PF13414 | TPR_11 | 1.92 |
PF13088 | BNR_2 | 0.96 |
PF01229 | Glyco_hydro_39 | 0.96 |
PF13444 | Acetyltransf_5 | 0.96 |
PF07587 | PSD1 | 0.96 |
PF03704 | BTAD | 0.96 |
PF13185 | GAF_2 | 0.96 |
PF13435 | Cytochrome_C554 | 0.96 |
PF00561 | Abhydrolase_1 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 4.81 |
COG1626 | Neutral trehalase | Carbohydrate transport and metabolism [G] | 2.88 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.96 |
COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.96 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.12 % |
Unclassified | root | N/A | 2.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10366027 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300001867|JGI12627J18819_10004786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5108 | Open in IMG/M |
3300002917|JGI25616J43925_10000650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12709 | Open in IMG/M |
3300004633|Ga0066395_10870052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 544 | Open in IMG/M |
3300005171|Ga0066677_10440420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 746 | Open in IMG/M |
3300005178|Ga0066688_10140761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1505 | Open in IMG/M |
3300005187|Ga0066675_10646931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 794 | Open in IMG/M |
3300005332|Ga0066388_100454993 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300005332|Ga0066388_101229579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1284 | Open in IMG/M |
3300005338|Ga0068868_101885504 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005345|Ga0070692_11290999 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005518|Ga0070699_100479018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1129 | Open in IMG/M |
3300005538|Ga0070731_10328909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1015 | Open in IMG/M |
3300005546|Ga0070696_100877276 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300005575|Ga0066702_10304450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 972 | Open in IMG/M |
3300006028|Ga0070717_10207129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1720 | Open in IMG/M |
3300006032|Ga0066696_10339686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 978 | Open in IMG/M |
3300006354|Ga0075021_10792169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300006800|Ga0066660_10860798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
3300007788|Ga0099795_10359797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300009038|Ga0099829_10857459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 754 | Open in IMG/M |
3300009038|Ga0099829_11471057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300009090|Ga0099827_10121377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2105 | Open in IMG/M |
3300009143|Ga0099792_11056078 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300009521|Ga0116222_1431046 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300009522|Ga0116218_1299759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300009792|Ga0126374_10222777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
3300010048|Ga0126373_10929964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
3300010359|Ga0126376_12659036 | Not Available | 549 | Open in IMG/M |
3300010360|Ga0126372_11523891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300010376|Ga0126381_102965556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300010398|Ga0126383_12379981 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300010399|Ga0134127_10262511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1643 | Open in IMG/M |
3300011077|Ga0138572_1019981 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300011269|Ga0137392_10455956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300011270|Ga0137391_10991736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300012096|Ga0137389_10050986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3127 | Open in IMG/M |
3300012096|Ga0137389_10382349 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300012200|Ga0137382_10562647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
3300012203|Ga0137399_11558747 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012205|Ga0137362_11046717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300012205|Ga0137362_11524532 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012208|Ga0137376_10566223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
3300012354|Ga0137366_10317227 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300012582|Ga0137358_10560320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
3300012917|Ga0137395_10622810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
3300012917|Ga0137395_10920620 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300012923|Ga0137359_10308923 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
3300012925|Ga0137419_10796163 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300012929|Ga0137404_11119677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
3300012929|Ga0137404_11523567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300012930|Ga0137407_11066373 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300012944|Ga0137410_11882302 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012971|Ga0126369_10672038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
3300012989|Ga0164305_11983603 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300013307|Ga0157372_13043481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300014498|Ga0182019_10369904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
3300014502|Ga0182021_10013646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9646 | Open in IMG/M |
3300014969|Ga0157376_13072488 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300015372|Ga0132256_100077875 | All Organisms → cellular organisms → Bacteria | 3162 | Open in IMG/M |
3300015373|Ga0132257_104031654 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300016357|Ga0182032_12020310 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300016371|Ga0182034_10069936 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
3300016371|Ga0182034_11635042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300017961|Ga0187778_10006599 | All Organisms → cellular organisms → Bacteria | 7473 | Open in IMG/M |
3300017961|Ga0187778_11154471 | Not Available | 541 | Open in IMG/M |
3300018058|Ga0187766_11235934 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300018468|Ga0066662_10219412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1523 | Open in IMG/M |
3300019870|Ga0193746_1013778 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300020581|Ga0210399_10919910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
3300021088|Ga0210404_10033402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2322 | Open in IMG/M |
3300021088|Ga0210404_10778962 | Not Available | 546 | Open in IMG/M |
3300021170|Ga0210400_10585526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
3300021178|Ga0210408_11153072 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300021479|Ga0210410_11669436 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300025930|Ga0207701_10103293 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
3300026078|Ga0207702_11429972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300026121|Ga0207683_10003704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13268 | Open in IMG/M |
3300026330|Ga0209473_1079125 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300026542|Ga0209805_1157762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
3300026552|Ga0209577_10332262 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300027174|Ga0207948_1042778 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300027576|Ga0209003_1002525 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
3300027604|Ga0208324_1111991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300027706|Ga0209581_1152874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300027854|Ga0209517_10742976 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300027875|Ga0209283_10123732 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300030294|Ga0311349_10179608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1991 | Open in IMG/M |
3300030707|Ga0310038_10371241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1158747 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300031753|Ga0307477_10169651 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
3300031753|Ga0307477_10803038 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300031754|Ga0307475_11060193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300031795|Ga0318557_10103786 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300031820|Ga0307473_11512181 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031823|Ga0307478_11219422 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031910|Ga0306923_10798816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
3300031954|Ga0306926_11157385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300031962|Ga0307479_10354162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1451 | Open in IMG/M |
3300032089|Ga0318525_10671183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300032180|Ga0307471_103641696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300032261|Ga0306920_101328347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
3300032783|Ga0335079_10579487 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300032892|Ga0335081_10041446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7304 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.73% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.73% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.96% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_103660272 | 3300001356 | Peatlands Soil | NGANGCIDCQGGTNGQITDIEAGTSMRALQFALRFDF* |
JGI12627J18819_100047865 | 3300001867 | Forest Soil | FSQNNGANGCVDCPGGNNGKITALEGGTHMRQLEFAVRLEF* |
JGI25616J43925_100006501 | 3300002917 | Grasslands Soil | VYAFSGNNGANPCIDCQGGNNGKITGLEGGTEMRALQFALRLSF* |
Ga0066395_108700522 | 3300004633 | Tropical Forest Soil | PVYAFSANNGANGCVDCQGGNNGKITGLEGGTNMRALQFAIRFDF* |
Ga0066677_104404201 | 3300005171 | Soil | YAFSANNGANGCVDCQGGNNGKITGLEGGTNMRQLQFALRFDF* |
Ga0066688_101407612 | 3300005178 | Soil | VFNHPVYAFSANNGGNTCVDCQGGNNGKITGLEGGTNMRQIQFALRFDF* |
Ga0066675_106469312 | 3300005187 | Soil | HPVYAFSQNNGANGCIDCQGGNNGKITSLESGTTMRQLQFAIRLDF* |
Ga0066388_1004549931 | 3300005332 | Tropical Forest Soil | LMNAFNIFNHPVYAFSQNNGANGCVDCQGGNNGKITGLEGGTHMRQLEFAVRFEF* |
Ga0066388_1012295791 | 3300005332 | Tropical Forest Soil | KFLMNAFNIFNHPVYAFSQNNGANGCVDCQGGNNGKITGLEGGTHMRQLEFALRFEF* |
Ga0068868_1018855041 | 3300005338 | Miscanthus Rhizosphere | FSANNGANGCVDCQGGNNGKITGLEGGTTMRQLQFAIRFDF* |
Ga0070692_112909991 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PVYAFSANNGANGCVDCQGGNNGKITGLEGGTTMRQLQFAIRFDF* |
Ga0070699_1004790181 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FRTDFFNIFNHPVYAFGATNGAQTCIDCQGGNNGKITQLEYGSSMRQIQFALRFDF* |
Ga0070731_103289091 | 3300005538 | Surface Soil | PVYAFSQNNGANGCIDCQGGNNGKITALENGTTMRQLQFAIRFDF* |
Ga0070696_1008772761 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VFNHPVYAFSQNNGANGCIDCQGGNNGKITALEGGTTMRQLQFAIRFDF* |
Ga0066702_103044502 | 3300005575 | Soil | FNHPVYAFSANNGANGCVDCQGGNNGKITGLEGGTNMRQLQFALRFDF* |
Ga0070717_102071293 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ANNGAQTCIDCQGGNNGKITGLEGGTTMRELQFALRFDF* |
Ga0066696_103396862 | 3300006032 | Soil | FNHPVYAFSQNNGANGCIDCQGGNNGKITSLESGTTMRQLQFAIRLDF* |
Ga0075021_107921691 | 3300006354 | Watersheds | DAFNVFNHPVYNFSANSGANNCIDCQGGTNGKITDLEQGTRMRAIQWAVRFDF* |
Ga0066660_108607981 | 3300006800 | Soil | GANGCVDCQGGNNGKITGLEGGTSMRQLQFALRFDF* |
Ga0099795_103597972 | 3300007788 | Vadose Zone Soil | HPVYAFSQNNGANGCIDCQGGNNGKITALEGGTTMRQLQFAIRFDF* |
Ga0099829_108574591 | 3300009038 | Vadose Zone Soil | NGANGCIDCQGGNNGKITALEGGTTMRQLQFAIRFDF* |
Ga0099829_114710571 | 3300009038 | Vadose Zone Soil | PVYAFSANNGANNCINCLGGNNGKITSLEGGTSMRALQFAVRFDF* |
Ga0099827_101213773 | 3300009090 | Vadose Zone Soil | GGGRCIDCGGNNGKITDIEADTTMRQLQFALRFTF* |
Ga0099792_110560781 | 3300009143 | Vadose Zone Soil | RLSAQFRTDFFNIFNHPVYAFSANNGAQTCIDCSGGNNGKITGLEFGTTMRQIQFAVRLDF* |
Ga0116222_14310462 | 3300009521 | Peatlands Soil | NGCIDCQGGTNGQITDIEAGTSMRALQFALRFDF* |
Ga0116218_12997591 | 3300009522 | Peatlands Soil | ANGCIDCQGGTNGQITDIEAGTSMRALQFALRFDF* |
Ga0126374_102227772 | 3300009792 | Tropical Forest Soil | AKFLMNAFNIFNHPVYAFSQNNGANGCVDCQGGNNGKITGLEGGTHMRQLEFAVRFEF* |
Ga0126373_109299641 | 3300010048 | Tropical Forest Soil | HPVYAFSQNNGGNTCVDCQGGNNGKITNIEDGTSMRQLQFAIRFDF* |
Ga0126376_126590362 | 3300010359 | Tropical Forest Soil | VYAFSGNNGAQTCIDCQGGNNGKITNIEDTTSMRQLQFAIRLDF* |
Ga0126372_115238911 | 3300010360 | Tropical Forest Soil | GANTCIDCQGGNNGKITNIEDGTSMRQLQFAIRFDF* |
Ga0126381_1029655561 | 3300010376 | Tropical Forest Soil | FRMDAFNIFNHGVYAFSANNGAQTCIDCSGGNNGKITNLEDGTNMRQLQFAIRFDF* |
Ga0126383_123799811 | 3300010398 | Tropical Forest Soil | FNVFNHPVYAFSQNNGANGCIDCQGGTNGQITNLEYGSSMRQIQFSLRFDF* |
Ga0134127_102625111 | 3300010399 | Terrestrial Soil | FSANNGATTCIDCSGGNNGKITGLEGGTSMRQLQFAVRFDF* |
Ga0138572_10199811 | 3300011077 | Peatlands Soil | MDAFNVFNHPVFAFSGNNGANGCIDCQGGTNGQITDIEAGTSMR |
Ga0137392_104559562 | 3300011269 | Vadose Zone Soil | FNHPVYAFSANNGANNCIDCQGGNNGKITGLEGGTSMRGLQWALRFDF* |
Ga0137391_109917362 | 3300011270 | Vadose Zone Soil | AKFVFDAFNVFNHPVYAFSANNGANNCIDCQGGNNGKITGLEGGTSMRGLQWALRFDF* |
Ga0137389_100509861 | 3300012096 | Vadose Zone Soil | QNNGANGCIDCQGGNNGKITALEGGTTMRELQFAIRLDF* |
Ga0137389_103823492 | 3300012096 | Vadose Zone Soil | ANGCIDCQGGNNGKITALEGGTTMRELQFAIRLDF* |
Ga0137382_105626471 | 3300012200 | Vadose Zone Soil | HPVYAFSANNGANTCVDCPNATPDKNNGKITGLEGGTSMRQLQFGLRFDF* |
Ga0137399_115587471 | 3300012203 | Vadose Zone Soil | YAFSGNNGANPCIDCQGGNNGKITGLEGGTSMRALQFALRLTF* |
Ga0137362_110467171 | 3300012205 | Vadose Zone Soil | ANGCVDCPGGNNGKITALEGGTHMRQLEFAVRFEF* |
Ga0137362_115245321 | 3300012205 | Vadose Zone Soil | NHPVYAFSQNNGANGCIDCQGGNNGKITALESGSTMRQLQFAIRFDF* |
Ga0137376_105662232 | 3300012208 | Vadose Zone Soil | CNHRVYAFSGKNGANVCVDCQGGNNGKITDIEGGTTMRELQFALRLTF* |
Ga0137366_103172272 | 3300012354 | Vadose Zone Soil | FNHPVYAFSGNNGANGCVDCQGGNNGKITDIEGGTTMRELQFALRLNF* |
Ga0137358_105603202 | 3300012582 | Vadose Zone Soil | FNIFNHPVYAFSANNGANNCVDCQGGNNGKITQLEGGTTMRELQFALRLEF* |
Ga0137395_106228102 | 3300012917 | Vadose Zone Soil | ANGCIDCQGGNNGKITALESGSTMRQLQFAIRFDF* |
Ga0137395_109206201 | 3300012917 | Vadose Zone Soil | NGAQTCIDCSGGNNGKITQLEYGSSMRQVQFALRFDF* |
Ga0137359_103089232 | 3300012923 | Vadose Zone Soil | VFDAFNVFNHGVYAFSANNGANNCVDCGGDAGKIKGLEGGTSMRALQFAVRFDF* |
Ga0137419_107961631 | 3300012925 | Vadose Zone Soil | PVLAFSANNGANGCVDCQGGNNGKITGLEGGTNMRQLQFALRLEF* |
Ga0137404_111196771 | 3300012929 | Vadose Zone Soil | HPVYAFGATNGAQTCIDCQGGNNGKITQLEYGSSMRQIQFALRFDF* |
Ga0137404_115235672 | 3300012929 | Vadose Zone Soil | PVYAFGATNGAQTCIDCQGGNNGKITQLEYGSSMRQIQFALRFDF* |
Ga0137407_110663732 | 3300012930 | Vadose Zone Soil | NNGANTCVDCPNATPDKNNGKITGLEGGTTMRELQFGLRFDF* |
Ga0137410_118823021 | 3300012944 | Vadose Zone Soil | FNVFNHPVYAFSQNNGANGCIDCQGGNNGKITALESGTTMRQLQFAIRFDF* |
Ga0126369_106720381 | 3300012971 | Tropical Forest Soil | SQNNGANGCVDCQGGNNGKITGLEGGTHMRQIEFAVRFEF* |
Ga0164305_119836031 | 3300012989 | Soil | NAFNIFNHPVYAFSQNNGANGCVDCPGGNNGKITGLEGGTHMRQLEFAVRFEF* |
Ga0157372_130434811 | 3300013307 | Corn Rhizosphere | AFSANNGAQTCIDCQNVNGIGNNGRITGLEGGTNMRELQFALRFDF* |
Ga0182019_103699042 | 3300014498 | Fen | VFNHPVYAFSSNNNAGNSWNCIDCSSNNAGQIRGLEAGTSIRGLQWALRVDF* |
Ga0182021_100136461 | 3300014502 | Fen | NNGANNCVDCQGGNNGKITGLENGTSMRGLQFALRFNF* |
Ga0157376_130724881 | 3300014969 | Miscanthus Rhizosphere | GASTCIDCQGGNNGKITSLEGGTTMRQLQFAVRFDF* |
Ga0132256_1000778754 | 3300015372 | Arabidopsis Rhizosphere | GAQTCIDCQGGDNGKIKGLEGGTSMRQLQFAVRFDF* |
Ga0132257_1040316541 | 3300015373 | Arabidopsis Rhizosphere | RAEFVTDFFNIFNHPVYAFSANNGANGCVDCQGGTNGKITGLEGGTNMRQIQFALRFEF* |
Ga0182032_120203102 | 3300016357 | Soil | NVPVYAFSGNNGANPCIDCQGGNNGKITGLETPGAMRQLQFAIRVDF |
Ga0182034_100699364 | 3300016371 | Soil | AFNVFNHPVFAFSSNNGANPCVDCGGGNNGKITGLEGGSHMRQLEFAVRFEF |
Ga0182034_116350422 | 3300016371 | Soil | DAFNIFNHPVYAFSANNGAQTCIDCAVGSTGKISNIEDGTNMRELQFALRFDF |
Ga0187778_100065991 | 3300017961 | Tropical Peatland | SANNGANTCVDCPGGNNGKITGLEFGTTMRQLEFAVRFEF |
Ga0187778_111544711 | 3300017961 | Tropical Peatland | NGAGGCVDSCGGNNGKITGLEGGTHMRQLEFAVRFEF |
Ga0187766_112359341 | 3300018058 | Tropical Peatland | MNAYNIFNHPVYAFSQNNGANSCVDCPGGNNGKITGLEGGTHMRQLEFAVRFEF |
Ga0066662_102194121 | 3300018468 | Grasslands Soil | AFSANNGANGCVDCQGGNNGKITGLEGGTNMRQLQFALRFDF |
Ga0193746_10137782 | 3300019870 | Soil | MDAFNIFNPCLCVFSANNGAKQCIDCTGGTNGDITNLEYGTTMRELQFALRFDF |
Ga0210399_109199101 | 3300020581 | Soil | FGATNGAQTCIDCSGGNNGKITQLEYGSSMRQVQFALRFDF |
Ga0210404_100334023 | 3300021088 | Soil | FIVNAFNVFNHGVYAFSQNNGANGCVDCPGGNNGKITALEGGTHMRQIEFAVRFEF |
Ga0210404_107789621 | 3300021088 | Soil | NGANGCVDCQGGTNGKITALEGGTGMRQLQFALRFEF |
Ga0210400_105855262 | 3300021170 | Soil | RMDAFNVFNHPVYAFSGNNGANPCVDCQGGNNGRITDIEGGTTMRELQFALRLNF |
Ga0210408_111530721 | 3300021178 | Soil | NHPVYAFSANNGASTCIDCAAFDNKGNPTTIGKITNIEDGSSMRQLQFAIRLDF |
Ga0210410_116694361 | 3300021479 | Soil | FNHPVYAFSQNNGANGCIDCQGGNNGKITALESGSTMRQLQFAIRFDF |
Ga0207701_101032934 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | YAFSANNGAQTCIDCQGGNNGKITGLEGGTSMRQLQFAVRFDF |
Ga0207702_114299721 | 3300026078 | Corn Rhizosphere | PVYAFSANNGAQTCIDCQGGDNGKIKGLEGGTSMRHFAFNAL |
Ga0207683_1000370412 | 3300026121 | Miscanthus Rhizosphere | SANNGAQTCIDCQGGNNGKITGLEGGTSMRQLQFAVRFDF |
Ga0209473_10791251 | 3300026330 | Soil | HPVYAFSQNNGANGCIDCQGGNNGKITSLESGTTMRQLQFAIRLDF |
Ga0209805_11577622 | 3300026542 | Soil | QNNGANGCVDCPGGNNGKITALEGGTHMRQLEFAVRFEF |
Ga0209577_103322621 | 3300026552 | Soil | ANNGAQTCIDCSGGNNGKITGLEFGTTMRQIQFAVRLDF |
Ga0207948_10427781 | 3300027174 | Forest Soil | FRAKFLMNAYNIFNHPVYAFSQNNGANGCVDCPGGNNGKITALEGGTHMRQLEFAVRLEF |
Ga0209003_10025253 | 3300027576 | Forest Soil | AFNIFNHPVYAFSQNNGANGCVDCQGGNNGKITALEGGTHMRQLEFAVRFEF |
Ga0208324_11119911 | 3300027604 | Peatlands Soil | FAFSGNNGANGCIDCQGGTNGQITDIEAGTSMRALQFALRFDF |
Ga0209581_11528742 | 3300027706 | Surface Soil | RMDAFNVFNHPVYAFSQNNGASTCIDCTNGTNGTNGFITGLEQGTNMRELQFALRFDF |
Ga0209517_107429762 | 3300027854 | Peatlands Soil | VFNHPVYAFSGNNGANPCIDCQGGTNGKITDIEGGTTMRELQFAIRFDF |
Ga0209283_101237321 | 3300027875 | Vadose Zone Soil | FNHPVYAFSGNNGANPCIDCQGGNNGKITGLEGGTEMRALQFALRLSF |
Ga0311349_101796081 | 3300030294 | Fen | ANNCIDCQGGNNGKITGLEGGTSMRALQFAVRFDF |
Ga0310038_103712411 | 3300030707 | Peatlands Soil | NGANGCIDCQGGTNGQITDIEAGTSMRALQFALRFDF |
(restricted) Ga0255311_11587471 | 3300031150 | Sandy Soil | YAFSQNNGANGCIDCQGGNNGKITSLEGGTTMRQLQFAIRFDF |
Ga0307477_101696511 | 3300031753 | Hardwood Forest Soil | VYAFSQNNGANGCVDCPGGNNGKITALEGGTHMRQLEFAVRLEF |
Ga0307477_108030382 | 3300031753 | Hardwood Forest Soil | YAFSANNGANNCVDCQGGNNGKITGLEGGTHMRQIEFAVRLEF |
Ga0307475_110601931 | 3300031754 | Hardwood Forest Soil | NGANGCVDCQGGTNGQITDIEAGTSMRALQFAIRFNF |
Ga0318557_101037861 | 3300031795 | Soil | FLMNAFNVFNHPVFAFSSNNGANPCVDCGGGNNGKITGLEGGSHMRQLEFAVRFEF |
Ga0307473_115121812 | 3300031820 | Hardwood Forest Soil | NLFNHPVYAFSANNGANNCVDCQNATADGNNGKITGLEGGTNMRQIQFALRLDF |
Ga0307478_112194221 | 3300031823 | Hardwood Forest Soil | TERFKAKFLVNAFNIFNHPVYAFSANNGANNCVDCQGGNNGKITGLEGGTHMRQIEFAVRLEF |
Ga0306923_107988161 | 3300031910 | Soil | FRMDAFNIFNHPVYAFSANNGAQTCIDCAVGSTGKISNIEDGTNMRELQFALRFDF |
Ga0306926_111573851 | 3300031954 | Soil | NNGANPCIDCQGGNNGKITGLETPGAMRQLQFAIRVDF |
Ga0307479_103541623 | 3300031962 | Hardwood Forest Soil | NHPVYAFSQNNGANGCIDCQGGNNGKITALEGGTTMRELQFAIRLDF |
Ga0318525_106711832 | 3300032089 | Soil | SSNNGANPCVDCGGGNNGKITGLEGGSHMRQLEFAVRFEF |
Ga0307471_1036416962 | 3300032180 | Hardwood Forest Soil | NHPVFAFSANNGANGCVDCQGGNNGKITALEGGTSMRQLQFALRFDF |
Ga0306920_1013283471 | 3300032261 | Soil | FSANNGAQTCIDCAVGSTGKISNIEDGTNMRELQFALRFDF |
Ga0335079_105794872 | 3300032783 | Soil | ANSANNGAQTCIDCSGGNNGKITNLEDGTSMRQLQFAIRFDF |
Ga0335081_100414461 | 3300032892 | Soil | FNHPVYAFSANNGAQTCIDCSGGNNGKITNLEDGTTMRQLQFAIRFDF |
⦗Top⦘ |