NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098127

Metagenome / Metatranscriptome Family F098127

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098127
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 35 residues
Representative Sequence MGTLDVPEILIGLGLVAGLFWALYNWTHPHENAPK
Number of Associated Samples 68
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.95 %
% of genes near scaffold ends (potentially truncated) 3.85 %
% of genes from short scaffolds (< 2000 bps) 42.31 %
Associated GOLD sequencing projects 62
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.654 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(16.346 % of family members)
Environment Ontology (ENVO) Unclassified
(29.808 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.231 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 34.92%    β-sheet: 0.00%    Coil/Unstructured: 65.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00809Pterin_bind 8.65
PF13620CarboxypepD_reg 8.65
PF00076RRM_1 7.69
PF00873ACR_tran 7.69
PF00196GerE 6.73
PF01596Methyltransf_3 4.81
PF02702KdpD 3.85
PF13709DUF4159 2.88
PF00069Pkinase 2.88
PF13676TIR_2 2.88
PF01103Omp85 1.92
PF04014MazE_antitoxin 1.92
PF13188PAS_8 1.92
PF11453DUF2950 0.96
PF03484B5 0.96
PF01409tRNA-synt_2d 0.96
PF13560HTH_31 0.96
PF03147FDX-ACB 0.96
PF02321OEP 0.96
PF02517Rce1-like 0.96
PF12704MacB_PCD 0.96
PF00291PALP 0.96
PF08530PepX_C 0.96
PF14259Obsolete Pfam Family 0.96
PF00326Peptidase_S9 0.96
PF02653BPD_transp_2 0.96
PF13517FG-GAP_3 0.96
PF01850PIN 0.96
PF10128OpcA_G6PD_assem 0.96
PF01566Nramp 0.96
PF13464DUF4115 0.96
PF03737RraA-like 0.96
PF11737DUF3300 0.96
PF03454MoeA_C 0.96
PF02633Creatininase 0.96
PF04966OprB 0.96
PF03551PadR 0.96
PF01564Spermine_synth 0.96
PF01081Aldolase 0.96
PF13519VWA_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 11.54
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 4.81
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 4.81
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 4.81
COG2205K+-sensing histidine kinase KdpDSignal transduction mechanisms [T] 3.85
COG0072Phenylalanyl-tRNA synthetase beta subunitTranslation, ribosomal structure and biogenesis [J] 1.92
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.92
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.96
COG0016Phenylalanyl-tRNA synthetase alpha subunitTranslation, ribosomal structure and biogenesis [J] 0.96
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 0.96
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.96
COG2024O-phosphoseryl-tRNA(Cys) synthetaseTranslation, ribosomal structure and biogenesis [J] 0.96
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.96
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.96
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.96
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.96
COG1402Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)Coenzyme transport and metabolism [H] 0.96
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.96
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.96
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.96
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.65 %
UnclassifiedrootN/A16.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_87130_len_732_cov_6_960382Not Available782Open in IMG/M
2140918024|NODE_491286_length_3551_cov_10.244157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3601Open in IMG/M
3300001356|JGI12269J14319_10032508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3432Open in IMG/M
3300005534|Ga0070735_10010538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7113Open in IMG/M
3300005537|Ga0070730_10010580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7568Open in IMG/M
3300005541|Ga0070733_10012003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5453Open in IMG/M
3300005921|Ga0070766_10173389All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300006052|Ga0075029_100025182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3351Open in IMG/M
3300006052|Ga0075029_100605295All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium732Open in IMG/M
3300006052|Ga0075029_100607036All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium731Open in IMG/M
3300006059|Ga0075017_100233998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1339Open in IMG/M
3300006162|Ga0075030_100375209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1134Open in IMG/M
3300006163|Ga0070715_10332415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis824Open in IMG/M
3300006797|Ga0066659_11058245All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli678Open in IMG/M
3300009548|Ga0116107_1046859All Organisms → cellular organisms → Bacteria → Acidobacteria1491Open in IMG/M
3300009628|Ga0116125_1136646All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300010376|Ga0126381_100059497All Organisms → cellular organisms → Bacteria4714Open in IMG/M
3300010379|Ga0136449_100049669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9463Open in IMG/M
3300010379|Ga0136449_100430215Not Available2326Open in IMG/M
3300010379|Ga0136449_103616166Not Available586Open in IMG/M
3300010937|Ga0137776_1796396Not Available607Open in IMG/M
3300011270|Ga0137391_10019341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5603Open in IMG/M
3300012210|Ga0137378_10183463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1946Open in IMG/M
3300014155|Ga0181524_10034283All Organisms → cellular organisms → Bacteria → Acidobacteria3448Open in IMG/M
3300014158|Ga0181521_10012606All Organisms → cellular organisms → Bacteria → Acidobacteria7914Open in IMG/M
3300014160|Ga0181517_10124304All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300014161|Ga0181529_10000290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus74035Open in IMG/M
3300014200|Ga0181526_10038490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3073Open in IMG/M
3300014494|Ga0182017_10043327All Organisms → cellular organisms → Bacteria3020Open in IMG/M
3300014494|Ga0182017_10893014All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300014496|Ga0182011_10020275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4833Open in IMG/M
3300014496|Ga0182011_10647750All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300014502|Ga0182021_10078336All Organisms → cellular organisms → Bacteria → Acidobacteria3837Open in IMG/M
3300014502|Ga0182021_10632013All Organisms → cellular organisms → Bacteria → Acidobacteria1282Open in IMG/M
3300014839|Ga0182027_10013029All Organisms → cellular organisms → Bacteria11634Open in IMG/M
3300014839|Ga0182027_10175700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2503Open in IMG/M
3300014839|Ga0182027_10211174All Organisms → cellular organisms → Bacteria → Acidobacteria2244Open in IMG/M
3300014839|Ga0182027_10574790All Organisms → cellular organisms → Bacteria → Acidobacteria1216Open in IMG/M
3300014839|Ga0182027_10578999All Organisms → cellular organisms → Bacteria → Acidobacteria1211Open in IMG/M
3300014839|Ga0182027_10707736Not Available1066Open in IMG/M
3300016750|Ga0181505_10440575All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300017929|Ga0187849_1006958All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8427Open in IMG/M
3300017934|Ga0187803_10004210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5686Open in IMG/M
3300017941|Ga0187850_10017538All Organisms → cellular organisms → Bacteria → Acidobacteria4232Open in IMG/M
3300017966|Ga0187776_11027176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales607Open in IMG/M
3300017973|Ga0187780_10718402All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300017988|Ga0181520_10088706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2699Open in IMG/M
3300017988|Ga0181520_10276663All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300017995|Ga0187816_10587079Not Available501Open in IMG/M
3300017999|Ga0187767_10075766All Organisms → cellular organisms → Bacteria → Acidobacteria889Open in IMG/M
3300018023|Ga0187889_10007229All Organisms → cellular organisms → Bacteria → Acidobacteria8138Open in IMG/M
3300019273|Ga0187794_1059559Not Available513Open in IMG/M
3300020581|Ga0210399_10026913All Organisms → cellular organisms → Bacteria → Acidobacteria4581Open in IMG/M
3300021478|Ga0210402_10000061All Organisms → cellular organisms → Bacteria → Acidobacteria111150Open in IMG/M
3300021559|Ga0210409_11602971All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300021858|Ga0213852_1191638All Organisms → cellular organisms → Bacteria → Acidobacteria1910Open in IMG/M
3300021861|Ga0213853_10422884Not Available764Open in IMG/M
3300021861|Ga0213853_10946455Not Available504Open in IMG/M
3300022524|Ga0224534_1001396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus12795Open in IMG/M
3300023090|Ga0224558_1014680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4383Open in IMG/M
3300025888|Ga0209540_10066963All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300026319|Ga0209647_1211348All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli664Open in IMG/M
3300027641|Ga0208827_1074023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1071Open in IMG/M
3300027825|Ga0209039_10001381All Organisms → cellular organisms → Bacteria → Acidobacteria22739Open in IMG/M
3300027857|Ga0209166_10026263All Organisms → cellular organisms → Bacteria → Acidobacteria3569Open in IMG/M
3300027867|Ga0209167_10011541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4187Open in IMG/M
3300027889|Ga0209380_10255184All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300027898|Ga0209067_10000269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus35940Open in IMG/M
3300027911|Ga0209698_10378527All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300027911|Ga0209698_10844452All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium690Open in IMG/M
3300027986|Ga0209168_10038960All Organisms → cellular organisms → Bacteria → Acidobacteria2587Open in IMG/M
3300031344|Ga0265316_10010869All Organisms → cellular organisms → Bacteria → Acidobacteria8266Open in IMG/M
3300031344|Ga0265316_10040265All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3747Open in IMG/M
3300031344|Ga0265316_10322283All Organisms → cellular organisms → Bacteria → Acidobacteria1122Open in IMG/M
3300031716|Ga0310813_10080575All Organisms → cellular organisms → Bacteria → Acidobacteria2483Open in IMG/M
3300032160|Ga0311301_10020115All Organisms → cellular organisms → Bacteria18925Open in IMG/M
3300032160|Ga0311301_10303759All Organisms → cellular organisms → Bacteria → Acidobacteria2553Open in IMG/M
3300032160|Ga0311301_10598949All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300032160|Ga0311301_12632561Not Available557Open in IMG/M
3300032770|Ga0335085_10018203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia10104Open in IMG/M
3300032770|Ga0335085_10100971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3728Open in IMG/M
3300032770|Ga0335085_10159581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2816Open in IMG/M
3300032770|Ga0335085_11566857All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300032770|Ga0335085_12028653All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300032783|Ga0335079_10006726All Organisms → cellular organisms → Bacteria13152Open in IMG/M
3300032783|Ga0335079_10008081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia11973Open in IMG/M
3300032783|Ga0335079_10041338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5293Open in IMG/M
3300032783|Ga0335079_10044925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5067Open in IMG/M
3300032783|Ga0335079_10147148All Organisms → cellular organisms → Bacteria2645Open in IMG/M
3300032783|Ga0335079_10437536Not Available1404Open in IMG/M
3300032805|Ga0335078_10915072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61051Open in IMG/M
3300032892|Ga0335081_10198363All Organisms → cellular organisms → Bacteria2781Open in IMG/M
3300033134|Ga0335073_10080762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4248Open in IMG/M
3300033402|Ga0326728_10060314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5274Open in IMG/M
3300033402|Ga0326728_10101471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3468Open in IMG/M
3300033402|Ga0326728_10119999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3028Open in IMG/M
3300033402|Ga0326728_10159960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2406Open in IMG/M
3300033891|Ga0334811_006144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium3477Open in IMG/M
3300034282|Ga0370492_0403837Not Available554Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil16.35%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen11.54%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil9.62%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds7.69%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.73%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.77%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.85%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.85%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.88%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.96%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.96%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300019273Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_000020702124908028SoilMGTPDVPEILIGLGLLAGIVWALYNWTHPHVDAPK
B_all_v_001233702140918024SoilPMGTPDVPEILIGLGLVAWLVWALYNWTHPHADAPK
JGI12269J14319_1003250833300001356Peatlands SoilMGTLDIPEILIGLGIVGCVIWAFYNWTHPHHGTPK*
Ga0070735_1001053823300005534Surface SoilMGSLDLPEVLIVIGLVVAVVWAVYNWTHPHPSAPK*
Ga0070730_1001058033300005537Surface SoilMGSLDVPEVLILLGLLACVAWALYHWTHPRPHLPK*
Ga0070733_1001200343300005541Surface SoilMGTLDVPEVLILLGLLAGILWGAYNWRHRHMGAPK*
Ga0070766_1017338933300005921SoilMAPLDIPEILIAVGIVGCIVWAIYNWTHPHADSHK*
Ga0075029_10002518253300006052WatershedsMGSLDVPEILIVLGLVAGLMWALYNWTHPHPNPPR*
Ga0075029_10060529523300006052WatershedsMRPLDVPEILIALGLVAGLMWAIYNWTHPHPNPPR*
Ga0075029_10060703623300006052WatershedsMRPLDVPEILIVLGLVAGLMWAIYNWTHPHPNPPR*
Ga0075017_10023399823300006059WatershedsMGSLDVPEVLIILGVVAGIVWALYNWKLTHPHRPR*
Ga0075030_10037520923300006162WatershedsMRPLDVPEILILLGVVAGLVWAVYIWTHPHPNRPQ*
Ga0070715_1033241513300006163Corn, Switchgrass And Miscanthus RhizosphereMGPLDVPEVLILLGLLIGVVWALYNWTHPHPHPPK*
Ga0066659_1105824523300006797SoilMGPLDVPEVLIFLGLVACIVWAVYNWTHPHPHPPK*
Ga0073928_1065516933300006893Iron-Sulfur Acid SpringMAALDVPEVLILLGILAIVAWAAYNWTHFRFGKPR*
Ga0116107_104685923300009548PeatlandMGTLDVPEILIGLGLVAGLFWALYNWTHPHENAPK*
Ga0116125_113664623300009628PeatlandMRPLDVPEILIALGLIATFAWAVYNWKHGTRAPR*
Ga0126381_10005949743300010376Tropical Forest SoilMGNLDVPEILIVIGFAACIAWALYNWTHPHPKQP*
Ga0136449_10004966953300010379Peatlands SoilMGTLDVPEVLIILGVVAGIVWAVYNWKLTHPHQPR*
Ga0136449_10038689913300010379Peatlands SoilMGSLDIPEILIILGILGGIAWGLYNWTHPNMDPRK*
Ga0136449_10043021533300010379Peatlands SoilMAHLDIPEILIALGIVGCIAWAIYNWTRPHTNTPG*
Ga0136449_10361616613300010379Peatlands SoilMATLDVPEILIGLGIVGCIAWAIYNWMHPRTNAPR*
Ga0137776_179639623300010937SedimentMGTLDIPEILIILGLVGGLAWGLYNWTHPHPRPGGQ*
Ga0137391_1001934143300011270Vadose Zone SoilMGSLDVPEVLIILGVVVGIAWAVYNWKLTHPHPPK*
Ga0137378_1018346323300012210Vadose Zone SoilMGAIDIPEILIGLGVVGCIIWAVYNRTHPRHGATK*
Ga0181524_1003428323300014155BogMGTLDVPEVLIGLGLLAGLFWALYNWTHPHVGTPK*
Ga0181521_1001260653300014158BogMGTPDVPEILIGLGLVAGLIWALYNWTHPHVDAPK*
Ga0181517_1012430433300014160BogMGTLDVPEILILLGILGGIAWAIYNWRHPYRSQRR*
Ga0181529_10000290393300014161BogMGHLDVPEVLILMGIIGGIAWAIYNWRHPHRERR*
Ga0181526_1003849023300014200BogMRTPDVPEVLIGLGVLAGLFWALYNWTHSRVDTLK*
Ga0182017_1004332723300014494FenMGTLDVPEVLIGLGLLAGLFWALYNWTHPHMNSPK*
Ga0182017_1089301423300014494FenMGTPDVPEILIGLGLLAGIVWALYNWTHPHVDAPK*
Ga0182011_1002027533300014496FenMRYPDVPEVLIALGVVGGIAWAIYNWTHPHRERR*
Ga0182011_1064775023300014496FenMRYPDVPEVLIALGIVGGIAWAIYNWTHPHRERR*
Ga0182021_1007833633300014502FenMRTLDVPEILIGLGLLAGLVWAVYNWTHPHVDAPK*
Ga0182021_1063201323300014502FenMRTLDVPEILIGLGLLAGFIWAVYNWTHPHVDAPK*
Ga0182027_1001302943300014839FenMRYPDVPEVLIVLGILGGIAWAIYNWTHPHRERR*
Ga0182027_1017570023300014839FenMRTPDVPEVLIGLGLLAGLFWAIYNWTHSHAGTPK*
Ga0182027_1021117433300014839FenMGTPDVPEILIGLGLVAGLVWALYNWTHPHVDAPK*
Ga0182027_1057479023300014839FenMRTPDVPEVLIGLGLLAGLLWAIYNWTHSHLGTPK*
Ga0182027_1057899933300014839FenMGTLDVPEVLIGLGLLAGLFWALYNWTHSHVGTPK*
Ga0182027_1070773633300014839FenMRTPDVPEVLIGLGLAAVLFWAIYNWTHSHVGTPK*
Ga0181505_1044057513300016750PeatlandMRTLDVPEILILLGILGGIAWAVYNWRRPHTGERR
Ga0187849_100695853300017929PeatlandMGTLDVPEILIGLGLVAGLFWALYNWTHPHENAPK
Ga0187803_1000421043300017934Freshwater SedimentMGALDVPEILIGLGIVACIAWAFYNWTHPRHGVTK
Ga0187850_1001753833300017941PeatlandMGTLDVPEVLIGLGLLAALAWALYNWSHPHPNAPK
Ga0187776_1102717613300017966Tropical PeatlandYTVLRRVHMGPLDVPEVLIILGVVAGIVWAVYNWKHAHPHSPK
Ga0187780_1071840223300017973Tropical PeatlandMGPLDVPEVLIILGIIAGIAWAIYNWTHPHPRLPG
Ga0181520_1008870623300017988BogMRTPDVPEVLIGLGLLAGLFWAVYNWTHSHLGTPK
Ga0181520_1027666323300017988BogMGTLDVPEILILLGILGGIAWAIYNWRHPYRSQRR
Ga0187816_1058707913300017995Freshwater SedimentMGPLDVPEVLIILGIIAGIAWAIYNWTHPDPHAPK
Ga0187767_1007576623300017999Tropical PeatlandMGPLDVPEVLIIVGVVATIAWAVYNWRHTHPHWPK
Ga0187889_1000722963300018023PeatlandMGTPDVPEILIGLGLVAGIVWALYNWTHPHVDAPK
Ga0187794_105955913300019273PeatlandGFMGNLDVPEILIVIGLIGCLAWALHNWRHAHGHHSK
Ga0210399_1002691323300020581SoilMGSLDVPEVLIILGVVVGIVWGVYNWRRTHRHSPR
Ga0210402_10000061423300021478SoilMGSLDVPEILIALGLAAGLMWAIHNWTHRRANPPR
Ga0210409_1160297123300021559SoilMRPLDVPEILIALGLVAGLMWAIYNWTHPHANPPR
Ga0213852_119163823300021858WatershedsMRPLDVPEILIVLGLVAGLMWAIYNWTHPHPNPPR
Ga0213853_1042288413300021861WatershedsMASLDVPEILIVLGVAAGLLWAIYNWTHPHVNPPR
Ga0213853_1094645523300021861WatershedsMASLDVPEILIVLGLVAGLMWALYNWTHPHPNPPR
Ga0224534_100139663300022524SoilMGTLDVPEVLIGLGLLAGLFWALYNWTHSHVGTPK
Ga0224558_101468033300023090SoilMRALDVPEMLIGLGLVAGLIWALYNWTHPRVNAPK
Ga0209540_1006696323300025888Arctic Peat SoilMGTPDVPEILIGLGLLAGLVWALYNWIHPRVDAPK
Ga0209647_121134813300026319Grasslands SoilVHMGPLDVPEVLILLGLVVCVAWGLYNWMHTHPHLHK
Ga0208827_107402323300027641Peatlands SoilMGTLDIPEILIGLGIVGCVIWAFYNWTHPHHGTPK
Ga0209039_10001381143300027825Bog Forest SoilMRTLDVPEILIGLGLLAGLVWAVYNWTHPHENAPK
Ga0209166_1002626343300027857Surface SoilMGSLDVPEVLILLGLLACVAWALYHWTHPRPHLPK
Ga0209167_1001154143300027867Surface SoilMGTLDVPEVLILLGLLAGILWGAYNWRHRHMGAPK
Ga0209380_1025518423300027889SoilMAPLDIPEILIAVGIVGCIVWAIYNWTHPHADSHK
Ga0209067_1000026993300027898WatershedsMGSLDVPEILIVLGLVAGLMWALYNWTHPHPNPPR
Ga0209698_1037852723300027911WatershedsMRPLDVPEILILLGVVAGLVWAVYIWTHPHPNRPQ
Ga0209698_1084445213300027911WatershedsMRPLDVPEILIALGLVAGLMWAIYNWTHPHPNPPR
Ga0209168_1003896043300027986Surface SoilMGSLDLPEVLIVIGLVVAVVWAVYNWTHPHPSAPK
Ga0265316_1001086963300031344RhizosphereMRTPDVPEVLIGLGLLAGLFWAIYNWTHSHAGTPK
Ga0265316_1004026533300031344RhizosphereMRTLDVPEILIGLGLVAGLIWALYNWTHPHIDAPK
Ga0265316_1032228323300031344RhizosphereMQTPDVPEVLIGLGLLAGLFWAIYNWTHSRLGTPK
Ga0310813_1008057543300031716SoilMGPLDVPEVLILLGLVACIAWALYNWAHPHTHAPK
Ga0311301_1002011533300032160Peatlands SoilMRPLDVPEILIVLGIVGCIIWAVYNWTHPHRRTTK
Ga0311301_1030375933300032160Peatlands SoilMAHLDIPEILIALGIVGCIAWAIYNWTRPHTNTPG
Ga0311301_1059894933300032160Peatlands SoilMGSLDIPEVLIILGILGGIAWGVYNWTHPNMDLRK
Ga0311301_1263256123300032160Peatlands SoilMGSLDIPEILIILGILGEIAWGLYNWTHPSMDPRK
Ga0335085_1001820373300032770SoilMRSLDVPEVLIILGILAGLAWAVYNWTHPHASSHK
Ga0335085_1007411413300032770SoilMGHLDVPEVLILLGILGGIAWAIYNWRHPQPRARR
Ga0335085_1010097123300032770SoilMGSLDVPEILIVMFLFAGLMWAVYNWTHPHVDPPRR
Ga0335085_1015958123300032770SoilMSTLDIPEVLILLGIAAGIAWAIYNWTHPHYPTPRR
Ga0335085_1156685723300032770SoilMGPLDVPEVLIILGVVAGIVWAVYNWKHAHPHSPK
Ga0335085_1202865323300032770SoilMGNLDVPEILILLGLAGCVAWAIYNWTHPRPHIPR
Ga0335079_1000672673300032783SoilMHSLDVPEVLIILGILAGLAWAVYNWTHPHASSHK
Ga0335079_1000808123300032783SoilMGLLDVPEVLIILGIIAGVAWAIYNWTHPHPHSPR
Ga0335079_1004133823300032783SoilMGPLDVPEVLIILGIVAGIVWAVYNWTHPHPHAPK
Ga0335079_1004492533300032783SoilMGPLDVPEVLIILGVVAGIVWAVYNWKHSHPHSPR
Ga0335079_1014714823300032783SoilMGPLDVPEVLIILGVLAGLAWAVYNWTHPHASSHK
Ga0335079_1043753633300032783SoilMAPLDIPEILIAIGILGCIAWGIYNWMHSHHNAHK
Ga0335078_1002307233300032805SoilMGHLDVPEVLILLGILGGIAWAIYNWRHPHPRERR
Ga0335078_1069028123300032805SoilMGHLDVPEVLILLGILGGIAWAIYNWRHPQPRVRR
Ga0335078_1091507213300032805SoilMGTLDVPEILIGLGVVGCIVWAVYNWMHRHQGTTK
Ga0335081_1019836323300032892SoilMGPLDVPEILIGIGIIAAAVWAVYNWTHPQPKPSK
Ga0335073_1008076243300033134SoilMNSLDVGAVLIILGILGGLAWAVYNRLHSNASERK
Ga0326728_1006031423300033402Peat SoilMRTPDVPEILIGLGLVAGLFWALYNWTHPHVDAPK
Ga0326728_1010147133300033402Peat SoilMGTPDVPEILIGLGLVAGLIWALYNWTHPHVDAPK
Ga0326728_1011999923300033402Peat SoilMRTPDVPEVLIGLGLLAGLFWAVYNWMHSHVGTPK
Ga0326728_1015996023300033402Peat SoilMRPLDVPEILIVLGIAGCIVWAVYNWTHPHQRTTK
Ga0334811_006144_197_3043300033891SoilMRTPDVPEVLIGVGLLAGLFWAIYNWTHSRLGTPK
Ga0370492_0403837_365_4723300034282Untreated Peat SoilMAPLDVPEILIALGIVGCIAWAIYNWAHAHPNTPK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.