Metagenome / Metatranscriptome Family F097959

Basic Information
Family ID	F097959
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	39 residues
Representative Sequence	PDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD
Number of Associated Samples	91
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	85.58 %
Associated GOLD sequencing projects	88
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Most Common Taxonomy
Group	Bacteria (67.308 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.423 % of family members)
Environment Ontology (ENVO)	Unclassified (22.115 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (33.654 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF13565	HTH_32	3.85
PF13358	DDE_3	2.88
PF01710	HTH_Tnp_IS630	1.92
PF05598	DUF772	1.92
PF13751	DDE_Tnp_1_6	1.92
PF00480	ROK	1.92
PF09650	PHA_gran_rgn	0.96
PF07592	DDE_Tnp_ISAZ013	0.96
PF13384	HTH_23	0.96
PF03631	Virul_fac_BrkB	0.96
PF11974	bMG3	0.96
PF01970	TctA	0.96
PF04964	Flp_Fap	0.96
PF14497	GST_C_3	0.96
PF13005	zf-IS66	0.96
PF01926	MMR_HSR1	0.96
PF11014	DUF2852	0.96
PF12849	PBP_like_2	0.96
PF07819	PGAP1	0.96
PF00374	NiFeSe_Hases	0.96
PF00348	polyprenyl_synt	0.96
PF01726	LexA_DNA_bind	0.96
PF03929	PepSY_TM	0.96
PF02861	Clp_N	0.96
PF14224	DUF4331	0.96
PF13492	GAF_3	0.96
PF03466	LysR_substrate	0.96
PF06707	DUF1194	0.96
PF03401	TctC	0.96
PF03976	PPK2	0.96
PF00912	Transgly	0.96
PF00501	AMP-binding	0.96
PF14294	DUF4372	0.96
PF00149	Metallophos	0.96
PF00581	Rhodanese	0.96
PF05222	AlaDh_PNT_N	0.96
PF06411	HdeA	0.96
PF00899	ThiF	0.96
PF06035	Peptidase_C93	0.96
PF01522	Polysacc_deac_1	0.96
PF13586	DDE_Tnp_1_2	0.96
PF13532	2OG-FeII_Oxy_2	0.96
PF07045	DUF1330	0.96
PF09722	Xre_MbcA_ParS_C	0.96
PF14305	ATPgrasp_TupA	0.96
PF03435	Sacchrp_dh_NADP	0.96
PF04800	NDUS4	0.96
PF00005	ABC_tran	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG1940	Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain	Transcription [K]	3.85
COG3415	CRISPR-associated protein Csa3, CARF domain	Defense mechanisms [V]	1.92
COG2326	Polyphosphate kinase 2, PPK2 family	Energy production and conversion [C]	0.96
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.96
COG5009	Membrane carboxypeptidase/penicillin-binding protein	Cell wall/membrane/envelope biogenesis [M]	0.96
COG4953	Membrane carboxypeptidase/penicillin-binding protein PbpC	Cell wall/membrane/envelope biogenesis [M]	0.96
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	0.96
COG3672	Predicted transglutaminase-like protein	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG3333	TctA family transporter	General function prediction only [R]	0.96
COG3295	Uncharacterized conserved protein	Function unknown [S]	0.96
COG3259	Coenzyme F420-reducing hydrogenase, alpha subunit	Energy production and conversion [C]	0.96
COG3182	PepSY-associated TM region	Function unknown [S]	0.96
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.96
COG0142	Geranylgeranyl pyrophosphate synthase	Coenzyme transport and metabolism [H]	0.96
COG2267	Lysophospholipase, alpha-beta hydrolase superfamily	Lipid transport and metabolism [I]	0.96
COG1784	TctA family transporter	General function prediction only [R]	0.96
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	0.96
COG1075	Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold	Lipid transport and metabolism [I]	0.96
COG0744	Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase	Cell wall/membrane/envelope biogenesis [M]	0.96
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.96
COG0596	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold	Coenzyme transport and metabolism [H]	0.96
COG0542	ATP-dependent Clp protease, ATP-binding subunit ClpA	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG0374	Ni,Fe-hydrogenase I large subunit	Energy production and conversion [C]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.31 %
Unclassified	root	N/A	32.69 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	67.31 %
Unclassified	root	N/A	32.69 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	67.31 %
Unclassified	root	N/A	32.69 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	53.85 %
Unclassified	root	N/A	32.69 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	51.92 %
Unclassified	root	N/A	32.69 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	38.46 %
Unclassified	root	N/A	32.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.92 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.92 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.69 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	14.42 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	6.73 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	3.85 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	2.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.92 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.92 %
Pleomorphomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae	0.96 %
Stellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Stellaceae	0.96 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.69 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	11.54 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	3.85 %
Aquabacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter	2.88 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.92 %
Stella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Stellaceae → Stella	0.96 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.96 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.96 %
unclassified Rhodospirillaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae	0.96 %
Methylocella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella	0.96 %
Rhodoblastus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus	0.96 %
Methylocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa	0.96 %
Pleomorphomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.69 %
Aquabacter spiritensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis	2.88 %
unclassified Methylocystis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis	1.92 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	1.92 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.92 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.96 %
unclassified Methylobacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium	0.96 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.96 %
Candidatus Rhodoblastus alkanivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans	0.96 %
unclassified Methylocapsa	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa	0.96 %
Rhodospirillaceae bacterium LM-1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium LM-1	0.96 %
Stella humosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Stellaceae → Stella → Stella humosa	0.96 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.96 %
Methylocella silvestris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris	0.96 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas → environmental samples	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	32.69 %
Aquabacter spiritensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis	2.88 %
Methylocystis sp. SC2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2	1.92 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.92 %
Bradyrhizobium diazoefficiens SEMIA 5080	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens → Bradyrhizobium diazoefficiens SEMIA 5080	0.96 %
Bradyrhizobium sp. WSM2254	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2254	0.96 %
Methylocapsa sp. S129	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129	0.96 %
Methylobacterium sp. WL6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL6	0.96 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.96 %
uncultured Pleomorphomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas → environmental samples → uncultured Pleomorphomonas sp.	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Candidatus Rhodoblastus alkanivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans	0.96 %
Rhodospirillaceae bacterium LM-1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium LM-1	0.96 %
Stella humosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Stellaceae → Stella → Stella humosa	0.96 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.96 %
Methylocella silvestris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459002\|FZY7DQ102GXV9T	Not Available	537	Open in IMG/M
3300001081\|JGI12662J13196_1022085	Not Available	528	Open in IMG/M
3300001545\|JGI12630J15595_10044127	All Organisms → cellular organisms → Bacteria	899	Open in IMG/M
3300005277\|Ga0065716_1016576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	546	Open in IMG/M
3300005445\|Ga0070708_100983205	Not Available	791	Open in IMG/M
3300005598\|Ga0066706_11205976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	575	Open in IMG/M
3300005764\|Ga0066903_105317334	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300006041\|Ga0075023_100557735	Not Available	525	Open in IMG/M
3300006046\|Ga0066652_100232760	Not Available	1604	Open in IMG/M
3300006047\|Ga0075024_100758622	Not Available	539	Open in IMG/M
3300006052\|Ga0075029_100710901	Not Available	678	Open in IMG/M
3300006055\|Ga0097691_1064693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1193	Open in IMG/M
3300006057\|Ga0075026_100515563	Not Available	690	Open in IMG/M
3300006059\|Ga0075017_100255271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1283	Open in IMG/M
3300006086\|Ga0075019_11012678	Not Available	536	Open in IMG/M
3300006172\|Ga0075018_10727675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas → environmental samples → uncultured Pleomorphomonas sp.	539	Open in IMG/M
3300006175\|Ga0070712_101985495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	509	Open in IMG/M
3300006176\|Ga0070765_101722484	Not Available	588	Open in IMG/M
3300006176\|Ga0070765_101792872	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300006797\|Ga0066659_10883815	Not Available	745	Open in IMG/M
3300007788\|Ga0099795_10120794	Not Available	1047	Open in IMG/M
3300009038\|Ga0099829_10564236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	946	Open in IMG/M
3300009176\|Ga0105242_11012872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	839	Open in IMG/M
3300010147\|Ga0126319_1055221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	548	Open in IMG/M
3300010398\|Ga0126383_12941060	Not Available	556	Open in IMG/M
3300011270\|Ga0137391_10088632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2674	Open in IMG/M
3300011270\|Ga0137391_10163734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1938	Open in IMG/M
3300012201\|Ga0137365_11247949	Not Available	529	Open in IMG/M
3300012205\|Ga0137362_11417308	Not Available	581	Open in IMG/M
3300012349\|Ga0137387_10641585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	769	Open in IMG/M
3300012356\|Ga0137371_11404798	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300012527\|Ga0136633_1157997	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL6	871	Open in IMG/M
3300012917\|Ga0137395_10181402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1458	Open in IMG/M
3300012923\|Ga0137359_10187048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis	1850	Open in IMG/M
3300012925\|Ga0137419_11154413	Not Available	647	Open in IMG/M
3300012944\|Ga0137410_11414877	Not Available	605	Open in IMG/M
3300014200\|Ga0181526_10818814	Not Available	586	Open in IMG/M
3300014492\|Ga0182013_10015692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris	7271	Open in IMG/M
3300014499\|Ga0182012_10081225	Not Available	2489	Open in IMG/M
3300014638\|Ga0181536_10372847	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300014657\|Ga0181522_10907645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	543	Open in IMG/M
3300014838\|Ga0182030_10485535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1241	Open in IMG/M
3300014838\|Ga0182030_10597908	Not Available	1065	Open in IMG/M
3300014969\|Ga0157376_10151532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium LM-1	2091	Open in IMG/M
3300014969\|Ga0157376_10835113	Not Available	936	Open in IMG/M
3300015090\|Ga0167634_1001223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis	3178	Open in IMG/M
3300016319\|Ga0182033_10141459	All Organisms → cellular organisms → Bacteria	1843	Open in IMG/M
3300016319\|Ga0182033_11310365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	651	Open in IMG/M
3300017942\|Ga0187808_10512197	Not Available	557	Open in IMG/M
3300017972\|Ga0187781_10077234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2300	Open in IMG/M
3300018064\|Ga0187773_11257115	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300020012\|Ga0193732_1012699	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens → Bradyrhizobium diazoefficiens SEMIA 5080	1457	Open in IMG/M
3300020074\|Ga0194113_10133878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2	2091	Open in IMG/M
3300020083\|Ga0194111_10011423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2	9444	Open in IMG/M
3300020083\|Ga0194111_10288821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	1135	Open in IMG/M
3300020220\|Ga0194119_10010056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12548	Open in IMG/M
3300020220\|Ga0194119_10439618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	835	Open in IMG/M
3300020222\|Ga0194125_10635922	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300020579\|Ga0210407_10618358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans	844	Open in IMG/M
3300020583\|Ga0210401_10953003	All Organisms → cellular organisms → Bacteria	717	Open in IMG/M
3300020603\|Ga0194126_10015616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	9217	Open in IMG/M
3300021086\|Ga0179596_10683818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	519	Open in IMG/M
3300021168\|Ga0210406_10981986	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300021344\|Ga0193719_10077115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1447	Open in IMG/M
3300021405\|Ga0210387_10365393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1276	Open in IMG/M
3300021475\|Ga0210392_10667946	Not Available	773	Open in IMG/M
3300021478\|Ga0210402_10944342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129	789	Open in IMG/M
3300021860\|Ga0213851_1764581	Not Available	557	Open in IMG/M
3300025903\|Ga0207680_10756542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	696	Open in IMG/M
3300025916\|Ga0207663_11066864	Not Available	649	Open in IMG/M
3300025922\|Ga0207646_11614165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	559	Open in IMG/M
3300026482\|Ga0257172_1030343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	975	Open in IMG/M
3300026496\|Ga0257157_1064045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	626	Open in IMG/M
3300027846\|Ga0209180_10186463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Stellaceae → Stella → Stella humosa	1197	Open in IMG/M
3300027863\|Ga0207433_10099156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2254	2693	Open in IMG/M
3300027894\|Ga0209068_10247720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	990	Open in IMG/M
3300027898\|Ga0209067_10604353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	630	Open in IMG/M
3300027903\|Ga0209488_10073271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2541	Open in IMG/M
3300028047\|Ga0209526_10037858	All Organisms → cellular organisms → Bacteria	3394	Open in IMG/M
3300028138\|Ga0247684_1005581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis	1971	Open in IMG/M
3300028819\|Ga0307296_10592290	Not Available	607	Open in IMG/M
3300029625\|Ga0311297_1088746	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300029943\|Ga0311340_10059179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4462	Open in IMG/M
3300030873\|Ga0265751_107915	Not Available	647	Open in IMG/M
3300031057\|Ga0170834_100845984	Not Available	642	Open in IMG/M
3300031057\|Ga0170834_110989557	Not Available	1049	Open in IMG/M
3300031170\|Ga0307498_10024988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1410	Open in IMG/M
3300031231\|Ga0170824_107146114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1227	Open in IMG/M
3300031524\|Ga0302320_10713551	Not Available	1135	Open in IMG/M
3300031545\|Ga0318541_10311893	All Organisms → cellular organisms → Bacteria	877	Open in IMG/M
3300031669\|Ga0307375_10445115	All Organisms → cellular organisms → Bacteria → Proteobacteria	793	Open in IMG/M
3300031890\|Ga0306925_11743937	Not Available	599	Open in IMG/M
3300031912\|Ga0306921_11255545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	822	Open in IMG/M
3300031942\|Ga0310916_10910860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	737	Open in IMG/M
3300031947\|Ga0310909_10200510	All Organisms → cellular organisms → Bacteria	1658	Open in IMG/M
3300032261\|Ga0306920_101776557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	871	Open in IMG/M
3300032516\|Ga0315273_13216473	Not Available	505	Open in IMG/M
3300033402\|Ga0326728_10149000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2547	Open in IMG/M
3300033402\|Ga0326728_10437656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	1095	Open in IMG/M
3300033402\|Ga0326728_10710315	Not Available	753	Open in IMG/M
3300033405\|Ga0326727_10359349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	1372	Open in IMG/M
3300033405\|Ga0326727_10433581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	1183	Open in IMG/M
3300033405\|Ga0326727_10514775	Not Available	1035	Open in IMG/M
3300033405\|Ga0326727_10548130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	985	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	95.19%
Host-Associated	Host-Associated	4.81%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	70.19%
Aquatic	Environmental → Aquatic	25.00%
Plants	Host-Associated → Plants	4.81%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	61.54%
Freshwater	Environmental → Aquatic → Freshwater	14.42%
Sediment	Environmental → Aquatic → Sediment	8.65%
Peat	Environmental → Terrestrial → Peat	8.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.85%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.92%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.19%
Loam	Environmental → Terrestrial → Soil → Loam	9.62%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	8.65%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	8.65%
Lake	Environmental → Aquatic → Freshwater → Lake	7.69%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.77%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.88%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.92%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.96%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.96%
Ice	Environmental → Aquatic → Freshwater → Ice	0.96%
Clay	Environmental → Terrestrial → Soil → Clay	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.15%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	19.23%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	8.65%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	8.65%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	6.73%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.77%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.85%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	2.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.88%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.96%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.96%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.96%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	0.96%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.96%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.54%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	8.65%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.73%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	6.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.81%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	3.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.85%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.88%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.88%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.92%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.96%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.96%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.96%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.96%
Hot Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring	0.96%
Hot Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring	0.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.96%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.96%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.96%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.96%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.96%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459002	Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm	Environmental	Open in IMG/M
3300001081	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3	Environmental	Open in IMG/M
3300001545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1	Environmental	Open in IMG/M
3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0	Host-Associated	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006055	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012527	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06)	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014200	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG	Environmental	Open in IMG/M
3300014492	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG	Environmental	Open in IMG/M
3300014499	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG	Environmental	Open in IMG/M
3300014638	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG	Environmental	Open in IMG/M
3300014657	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG	Environmental	Open in IMG/M
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015090	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300017942	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300020012	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020083	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m	Environmental	Open in IMG/M
3300020220	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300020603	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021860	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026482	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B	Environmental	Open in IMG/M
3300026496	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027863	Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027898	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028138	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300029625	Mildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring	Environmental	Open in IMG/M
3300029943	I_Palsa_N3 coassembly	Environmental	Open in IMG/M
3300030873	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031524	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031669	Soil microbial communities from Risofladan, Vaasa, Finland - TR-1	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033402	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN	Environmental	Open in IMG/M
3300033405	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097959

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E1_02440010	2170459002	Grass Soil	GMFFRAQPHYVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD
JGI12662J13196_10220852	3300001081	Forest Soil	ESIAFLRVEPDHVFLDGNLFPGHESPPSLSCRDRDSEIPVMINDGGD*
JGI12630J15595_100441271	3300001545	Forest Soil	EPDHVFLDGNLFPGHESPPSLSCRDRDSEIPVMINDGGD*
Ga0065716_10165762	3300005277	Arabidopsis Rhizosphere	LVESIAFLRVEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD*
Ga0070708_1009832053	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	EPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD*
Ga0066706_112059761	3300005598	Soil	PDHVFLDGDLFPGHESPPSLACGDRDSEIPVMINDEGD*
Ga0066903_1053173341	3300005764	Tropical Forest Soil	PHYVLLDGNLFPDHESPPPLPCSDRDSEVAVIFNDGSD*
Ga0075023_1005577352	3300006041	Watersheds	LLDGNLFPDHESPPSLPCSDRDSEVAIIFNDGSD*
Ga0066652_1002327601	3300006046	Soil	AFLRAKPDHVFLDGNLFPGHESPPSLPCHDRDSEIPIMINDGGD*
Ga0075024_1007586221	3300006047	Watersheds	HYVLLDGNLFPDHESPPSLPCGDRDSEVPVIFNDGSD*
Ga0075029_1007109013	3300006052	Watersheds	RVEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD*
Ga0097691_10646931	3300006055	Arctic Peat Soil	LLDGDLFPGHESPPSLACGDRDSEVAVIFNDGGD*
Ga0075026_1005155631	3300006057	Watersheds	HVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD*
Ga0075017_1002552714	3300006059	Watersheds	HVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDVGD*
Ga0075019_110126783	3300006086	Watersheds	IAFLRVEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD*
Ga0075018_107276751	3300006172	Watersheds	QPHYVLLDGDLFPGHESPPSLACGDSDSEVAVIFNDGGD*
Ga0070712_1019854952	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	VLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD*
Ga0070765_1017224841	3300006176	Soil	HVFLDGNLFPGHESPPSLPCCDRDSEIPVMINDGGD*
Ga0070765_1017928722	3300006176	Soil	PHYVLLDGNLFPDHESPPSLPWGDRDSEVAVIFNDGTD*
Ga0066659_108838154	3300006797	Soil	LHVEPDHVFLDGDLFPGHESPPSLLCCDRDSEIPVMINDGGD*
Ga0099795_101207941	3300007788	Vadose Zone Soil	HYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDESD*
Ga0099829_105642361	3300009038	Vadose Zone Soil	HYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD*
Ga0105242_110128721	3300009176	Miscanthus Rhizosphere	PHYVLLDGDLFPGHESPPSLACGDRESEVAVIFNDGGD*
Ga0126319_10552211	3300010147	Soil	DHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD*
Ga0126383_129410603	3300010398	Tropical Forest Soil	GTFLRAQPHYVLLDGNLFPDHESPPSLAATESEIAVIFNDGGD*
Ga0137391_100886321	3300011270	Vadose Zone Soil	VFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD*
Ga0137391_101637341	3300011270	Vadose Zone Soil	VFLDGNLFRGHESPPSLACRDSDSENRVRFNDVSH*
Ga0137365_112479492	3300012201	Vadose Zone Soil	VEPDHVFLDGNLFPGHESPPSLLCRDRDSEIPVMINDGGD*
Ga0137362_114173081	3300012205	Vadose Zone Soil	FLDGNLFPGHESPPSPPCRDRDSEIPVMINDGGD*
Ga0137387_106415851	3300012349	Vadose Zone Soil	PHNVFLDGNLFRGHESPPSLACRDSDSENRIRFNDVSH*
Ga0137371_114047981	3300012356	Vadose Zone Soil	LRVEPDHVFLDGNLFPGHESPPSLPCRNRDSEIPVMINDGGD*
Ga0136633_11579971	3300012527	Polar Desert Sand	ELLDGNLFPGHESPPSLLISDSDSEIPVQINDGGY*
Ga0137395_101814021	3300012917	Vadose Zone Soil	FLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD*
Ga0137359_101870481	3300012923	Vadose Zone Soil	LLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD*
Ga0137419_111544131	3300012925	Vadose Zone Soil	LRAQPHYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGTD*
Ga0137410_114148771	3300012944	Vadose Zone Soil	YVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD*
Ga0181526_108188141	3300014200	Bog	PHYVLPDGNLFPDHESPPSPPCGDRDSELAVIFNDGSD*
Ga0182013_100156921	3300014492	Bog	AQPHHVFLDGDLSPGHESPPSLLRSNRDSEIAVEINDAGY*
Ga0182012_100812251	3300014499	Bog	HVFLDGDLSPGHESPPSLLRSNRDSEIAVEINDAGY*
Ga0181536_103728471	3300014638	Bog	PHNVFLDGNLFSGHESPPSLLRSDSDSELAAKINDRGH*
Ga0181522_109076451	3300014657	Bog	NVFLDGDLFPDHESPPSLLHSERDSEAALRINDGGH*
Ga0182030_104855351	3300014838	Bog	PRASRAQPHNVFLDGNLFPGHESPSSLLSSDSDSELAAKINDRGH*
Ga0182030_105979083	3300014838	Bog	QPHHVFLDGDLSPGHESPPSLLRSNRDSEIAVEINDAGY*
Ga0157376_101515322	3300014969	Miscanthus Rhizosphere	VFFRAQPHYVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD*
Ga0157376_108351131	3300014969	Miscanthus Rhizosphere	PDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD*
Ga0167634_10012234	3300015090	Glacier Forefield Soil	YVLLDGKLFPDHESPPSLACSDRDSEAPVIFNDGGD*
Ga0182033_101414591	3300016319	Soil	LVRAQPHNVFLGGDFFPGHESPPSLLRSNSDSELAVEINDGRH
Ga0182033_113103651	3300016319	Soil	AQPHNVFLGGDFFPGHESPPSLLRSNSDSELAVEINDGWH
Ga0187808_105121971	3300017942	Freshwater Sediment	YNILLDGNLLRGHESPPSFGRRNDSENCIRFNDVSN
Ga0187781_100772343	3300017972	Tropical Peatland	AQPNHVFLDGDLFPGHESPPSLLCSDRDSELTVKSNDGTH
Ga0187773_112571152	3300018064	Tropical Peatland	LLALVRAQPNHVFFDGDFIPGHESSPSLLPSDRDSELAIKSNDGGY
Ga0193732_10126991	3300020012	Soil	AQPHNVFLDGNLFRGHESPPSLACRDSDSENRIRFNDVSH
Ga0194113_101338783	3300020074	Freshwater Lake	AQPNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH
Ga0194111_100114231	3300020083	Freshwater Lake	PNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH
Ga0194111_102888211	3300020083	Freshwater Lake	RAQPNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH
Ga0194119_100100561	3300020220	Freshwater Lake	NHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH
Ga0194119_104396181	3300020220	Freshwater Lake	QPNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH
Ga0194125_106359222	3300020222	Freshwater Lake	ILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH
Ga0210407_106183581	3300020579	Soil	PDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD
Ga0210401_109530032	3300020583	Soil	RGQPHYVFLDGDLFPGHESPPSLACGDSDSEVAVIFNDGGD
Ga0194126_100156161	3300020603	Freshwater Lake	HILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH
Ga0179596_106838182	3300021086	Vadose Zone Soil	PHYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDESD
Ga0210406_109819861	3300021168	Soil	EPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD
Ga0193719_100771155	3300021344	Soil	RAQPHNVFLDGNLFRGHESPPSLACRDSDSENRIRFNDVSH
Ga0210387_103653931	3300021405	Soil	HVFFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD
Ga0210392_106679461	3300021475	Soil	PHYVLLDGNLFPDHESPPSLPCSDRDSEVAVIFNDGSD
Ga0210402_109443421	3300021478	Soil	VLLDGNLFPDHESPPSLPCSDRDSEVAVIFNDGSD
Ga0213851_17645811	3300021860	Watersheds	PHDVFLDGNLFPDHESPQSLLPSESDSEVHGIFNDASD
Ga0207680_107565422	3300025903	Switchgrass Rhizosphere	VEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD
Ga0207663_110668642	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	QPHYVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD
Ga0207646_116141651	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	DHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD
Ga0257172_10303431	3300026482	Soil	RGQPHYVLLDGDLFPGHESPPSLACGDRDSEVAVIFNDGGD
Ga0257157_10640451	3300026496	Soil	AQPHNVFLDGNLFRGHESPPSLACRDSDSENRVRFNDVSH
Ga0209180_101864632	3300027846	Vadose Zone Soil	AQPHYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD
Ga0207433_100991565	3300027863	Hot Spring	RAQPNNVFLDGDLLPGHESPPSLLLSGRDSQLAIKSNDGGY
Ga0209068_102477203	3300027894	Watersheds	RTQPDHVFLDGDLFPGHESPPSLACRDRDSEIPVTINDESD
Ga0209067_106043531	3300027898	Watersheds	QPHYVLLDGDLFPGHESPPPLACGDRDSEIAVIFNDGGD
Ga0209488_100732711	3300027903	Vadose Zone Soil	VFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDESD
Ga0209526_100378581	3300028047	Forest Soil	VFLDGNLFPGHESPPSLSCRDRDSEIPVMINDGGD
Ga0247684_10055811	3300028138	Soil	TFLRAQPHYVLLDGNLFPDHESPPSLPCSNRDSEVAVIFNDEGD
Ga0307296_105922901	3300028819	Soil	AQPHYVLLDGNLFPHHESSPSLPCGDRDSEVTVIFNDESD
Ga0311297_10887461	3300029625	Hot Spring	RDKLFPLIRAQPHNVFLDGNFFPGHEPPPALIDSDSDSELGVEINDRGH
Ga0311340_100591794	3300029943	Palsa	LLDGNLFPDHESPPSLPCAGDRDSEVAVIFNDGSD
Ga0265751_1079151	3300030873	Soil	VEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGDSL
Ga0170834_1008459841	3300031057	Forest Soil	HYVFLDGDLFPGHESPPSLACGDRDSEVAVIFNDGGD
Ga0170834_1109895572	3300031057	Forest Soil	FLRGQPHYVFLDGDLFPGHESPPSLACGDRDSQVAVIFNDGGD
Ga0307498_100249883	3300031170	Soil	HYVFLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD
Ga0170824_1071461141	3300031231	Forest Soil	HVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD
Ga0302320_107135511	3300031524	Bog	QTHDVFFNGDFFPGHESSPSLINSNRDSELTTEINDGGH
Ga0318541_103118933	3300031545	Soil	LHYVLLDGNLFPDHESPLPSLPCSDRDSEVTVIFNDGSD
Ga0307375_104451151	3300031669	Soil	LIAFLRAQPDHVFLDGDLFPGHESPPSLACGDRDSEIPVTINDESD
Ga0306925_117439371	3300031890	Soil	RVEPDHVFLDRNLFPRHESSPSLPRGDRDSEVPIIFNDGDD
Ga0306921_112555451	3300031912	Soil	VLLDGDLFPGHESPPSLACGDRDSEIAIIFNDGGD
Ga0310916_109108601	3300031942	Soil	TFLCGQPHDVLLDGDLFPGHESPPSLACGDRDSEIAVIFNDGGD
Ga0310909_102005101	3300031947	Soil	YVLLDGNLFPDHESPPSLPCSDRDSEVAVIFNDGSD
Ga0306920_1017765571	3300032261	Soil	FFRGQPHYVLLDGDLFPGHESPPSLACGDRDSEIAIIFNDGGD
Ga0315273_132164732	3300032516	Sediment	QPHNIFLDGNLFPGHESPPALLQGSDSENLVRLNDATD
Ga0326728_101490004	3300033402	Peat Soil	PNHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY
Ga0326728_104376561	3300033402	Peat Soil	VFLDGDLFPGHESPPPLLCRDRDSELAVKSNDGNH
Ga0326728_107103152	3300033402	Peat Soil	VQPNHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY
Ga0326727_103593491	3300033405	Peat Soil	ALLRAQPNHVFLDGDLFPGHESPPPLLCRDRDSELAVKSNDGNH
Ga0326727_104335813	3300033405	Peat Soil	NHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY
Ga0326727_105147752	3300033405	Peat Soil	HVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY
Ga0326727_105481303	3300033405	Peat Soil	RVQPNHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign