Basic Information | |
---|---|
Family ID | F097790 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | NYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGHDSDERAA |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 15.38 % |
% of genes from short scaffolds (< 2000 bps) | 14.42 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (84.615 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.462 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.192 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF07250 | Glyoxal_oxid_N | 2.88 |
PF00072 | Response_reg | 1.92 |
PF13360 | PQQ_2 | 1.92 |
PF01850 | PIN | 1.92 |
PF03100 | CcmE | 1.92 |
PF07690 | MFS_1 | 1.92 |
PF04134 | DCC1-like | 0.96 |
PF09118 | GO-like_E_set | 0.96 |
PF13466 | STAS_2 | 0.96 |
PF13581 | HATPase_c_2 | 0.96 |
PF05227 | CHASE3 | 0.96 |
PF00436 | SSB | 0.96 |
PF13414 | TPR_11 | 0.96 |
PF13668 | Ferritin_2 | 0.96 |
PF03631 | Virul_fac_BrkB | 0.96 |
PF13181 | TPR_8 | 0.96 |
PF09723 | Zn-ribbon_8 | 0.96 |
PF00857 | Isochorismatase | 0.96 |
PF01902 | Diphthami_syn_2 | 0.96 |
PF00575 | S1 | 0.96 |
PF03454 | MoeA_C | 0.96 |
PF16868 | NMT1_3 | 0.96 |
PF00156 | Pribosyltran | 0.96 |
PF00903 | Glyoxalase | 0.96 |
PF07228 | SpoIIE | 0.96 |
PF04075 | F420H2_quin_red | 0.96 |
PF12680 | SnoaL_2 | 0.96 |
PF00583 | Acetyltransf_1 | 0.96 |
PF03551 | PadR | 0.96 |
PF13548 | DUF4126 | 0.96 |
PF01292 | Ni_hydr_CYTB | 0.96 |
PF13091 | PLDc_2 | 0.96 |
PF00912 | Transgly | 0.96 |
PF01642 | MM_CoA_mutase | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 1.92 |
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.96 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.96 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.96 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.96 |
COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.96 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.96 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.96 |
COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.96 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.96 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.96 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.96 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.96 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.96 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.96 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 84.62 % |
All Organisms | root | All Organisms | 15.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005435|Ga0070714_101574002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300005542|Ga0070732_10292332 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300005586|Ga0066691_10926336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300009147|Ga0114129_11465094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
3300012495|Ga0157323_1021151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300014154|Ga0134075_10534377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300014501|Ga0182024_10543386 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300017972|Ga0187781_10000019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 119694 | Open in IMG/M |
3300018431|Ga0066655_10096654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1646 | Open in IMG/M |
3300020581|Ga0210399_10371732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1193 | Open in IMG/M |
3300020583|Ga0210401_10335094 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300022533|Ga0242662_10106572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300025223|Ga0207672_1008812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300025922|Ga0207646_11589490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300025937|Ga0207669_11931664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300027383|Ga0209213_1077357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.46% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0430.00006820 | 2162886012 | Miscanthus Rhizosphere | GFLPRQGHEYAEQIKEASIQMEQLRQDLVASPDRNRDAKAA |
JGI12636J13339_10297351 | 3300001154 | Forest Soil | GGFLPRQGHQYAEQMKEAAAEMERLRQDLVGSRGSEIDEKAA* |
JGI12712J15308_100860051 | 3300001471 | Forest Soil | NYGGFLPRQGHEYAEQIQEASAEMEQLRQDLVGAPCGNGDQKAA* |
JGI24749J21850_10101992 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | YAEQIREASAQMERLRQDLVGNPDSDNDEKAAYDSVA* |
Ga0070714_1015740021 | 3300005435 | Agricultural Soil | AIEANARLLLDNYGGFLPRQGHEYAEQIREASIQMERLRQDLVSGPSASGNGKAA* |
Ga0070705_1015804752 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QGHKYAEQIREASAQMERLRQDLVGNPDSDNDEKAAYDSVA* |
Ga0070708_1017592732 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGHDSDEKAA* |
Ga0068867_1002276391 | 3300005459 | Miscanthus Rhizosphere | ARLLLDNYGGFLPRQGHEYAEQIKEASIQMEQLRQDLVASPDRNRDAKAA* |
Ga0070684_1022074522 | 3300005535 | Corn Rhizosphere | GGFLPRQGHEYAEQIKEASIQMERLRQDLVASPSHTGDEKAA* |
Ga0070732_102923322 | 3300005542 | Surface Soil | SAIEANARLLLQNYGGFLPRQGHEYAEQIQEASAQMERLRQDLVGSPGSNGDAKAA* |
Ga0070664_1008255371 | 3300005564 | Corn Rhizosphere | SAIEANARLLLDNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPSHTGDERAA* |
Ga0066702_103983232 | 3300005575 | Soil | LENYGGFLPRQGHEYAEQIKEASAQMERLRKDLIADPASTDYEKLEYESVA* |
Ga0068854_1014939411 | 3300005578 | Corn Rhizosphere | RLLLENYGSFLPRQGHEYAEQINEAAAQMERLRLDLVGSRGSESDQAAA* |
Ga0066691_109263362 | 3300005586 | Soil | AIEASVRLLLQNYGGFLPRQGHEYAEQIREASAQMERLRQDLVGSSASNSDEKAA* |
Ga0070762_106462762 | 3300005602 | Soil | HKYAEQIKEASAQMERLRQDLVGSPGSNNEEKAAYDSVA* |
Ga0068870_103608363 | 3300005840 | Miscanthus Rhizosphere | DNYGGFLPRQGHEYAEQIKEASIQMEQLRQDLVASPDRNRDAKAA* |
Ga0070717_104605983 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GQKYAEQIEEASAQMEQLRQDLVGSPGFKTDEIVAYDSVA* |
Ga0070712_1009291942 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KTSAIEANARLLLDNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGHDSDEKAA* |
Ga0066660_114958081 | 3300006800 | Soil | SRLLLDNYGGFLPRQGHEYAEQMKDTAEELERLRQNLVASQGFQNAEQAA* |
Ga0068865_1003919481 | 3300006881 | Miscanthus Rhizosphere | ARLLLDNYGGFLPRQGHEYAEQIKEASIQMEQLRQDLVASPDRNSGEKAA* |
Ga0114129_114650941 | 3300009147 | Populus Rhizosphere | KTSAIEANARLLLENYGGFLPRQGHEYAEQIKEASIQMERLRQDLVDSPGSNSNGKAA* |
Ga0105237_124255192 | 3300009545 | Corn Rhizosphere | GGFLPRQGHEYAEQIKEASIQMEQLRQDLVAWPDRDREEKAA* |
Ga0116217_101155151 | 3300009700 | Peatlands Soil | YAEQIKEASAQMERLRQDLVGTPGSNNDEKAAYDSVA* |
Ga0116223_103178801 | 3300009839 | Peatlands Soil | QNYGGFLPRQGYEYAEQIREASAQMERLRQDLVGSSASHSDEKAA* |
Ga0074044_105374851 | 3300010343 | Bog Forest Soil | NYGGFLPRQGHEYAEQIREASAQMEQLRQDLVGSSGCNSNEKAA* |
Ga0134125_108153043 | 3300010371 | Terrestrial Soil | LENYGGFLPRQGHEYAEQMKEAAAEMELLRQDLVGHHGSQYGDEAA* |
Ga0134124_112923361 | 3300010397 | Terrestrial Soil | QGHEYAEQIKEASIQMERLRQDLVASPSHTGDEKAA* |
Ga0134127_114055211 | 3300010399 | Terrestrial Soil | NYGGFLPRQGHKYAEQIREASAQMERLRQDLVGNPDSDNDEKAAYDSVA* |
Ga0134122_1000287312 | 3300010400 | Terrestrial Soil | GGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGHDSDERAA* |
Ga0134121_102064592 | 3300010401 | Terrestrial Soil | LLDNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGHDSDERAA* |
Ga0134123_104264432 | 3300010403 | Terrestrial Soil | HEYAEQIKEASIQMERLRQDLVASPGHDSDERAA* |
Ga0105246_105388761 | 3300011119 | Miscanthus Rhizosphere | NYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGHDSDERAA* |
Ga0150983_135020552 | 3300011120 | Forest Soil | LLLENYGGFLPRQGHEYAEQMNEAAAQMERLRLDLVGSRNSGSDQQAA* |
Ga0153933_11018291 | 3300011411 | Attine Ant Fungus Gardens | GHEYAEQIQEASAEMEQLRQDLVGAPCGNGDQKAA* |
Ga0137383_104746521 | 3300012199 | Vadose Zone Soil | ANADLLLQNYGGFLPRQGHEYAEQIKVAAAQMEQLRQDLVGSPGTNTDEKAA* |
Ga0137362_117290612 | 3300012205 | Vadose Zone Soil | INTNSRLLLENYGGFLPRQGHEYAEQMKEAAAQMELLRQDLVGSRNGSDQQAA* |
Ga0137378_105251954 | 3300012210 | Vadose Zone Soil | ENYGGFLPRQGHEYAEQMKEAATQMERLRQDLVGSRSSDGDWKAA* |
Ga0137385_100830301 | 3300012359 | Vadose Zone Soil | GFLPRQGHEYAEQIKVAAAQMEQLRQDLVGSPGTNTDEKAA* |
Ga0157323_10211512 | 3300012495 | Arabidopsis Rhizosphere | SAIEVNSRLLLQNYGGFLPRQGHKYAEQIREASAQMERLRQDLVGNPDSDNDEKAAYDSVA* |
Ga0137419_118359802 | 3300012925 | Vadose Zone Soil | HEYAEQIKEASAQMEQLRQDLVGNPGSNGDEKAA* |
Ga0137419_119018881 | 3300012925 | Vadose Zone Soil | FLPRQGHEYAEQMKEAAAQMEQLRVDLVGSRGSGSDGKAA* |
Ga0137416_100923951 | 3300012927 | Vadose Zone Soil | NYGGFLPRQGHEYAEQMKEAAAQMEQLRVDLVGSRGSGSDGKAA* |
Ga0137404_104389092 | 3300012929 | Vadose Zone Soil | GGFLPRQGHEYAEQIKEAAAQMEQLRQDLVGIPGSNSSEKAA* |
Ga0137407_109197221 | 3300012930 | Vadose Zone Soil | NARLLLDNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGCNSDGKAA* |
Ga0164304_101858341 | 3300012986 | Soil | PRQGHEYAEQIQEASAEMELLRQDLLGGAGSSNKKAA* |
Ga0157374_108306252 | 3300013296 | Miscanthus Rhizosphere | LENYGSFLPRQGHEYAEQINEAAAQMERLRLDLVGSRGSESDQAAA* |
Ga0120109_10061091 | 3300014052 | Permafrost | TNSRLLLENYGGFLPRQGHEYAEQMKEAATQMERLRQDLVGNRSSDGDWKAA* |
Ga0134075_105343772 | 3300014154 | Grasslands Soil | AIEANARLLLENYGGFLPRQGHQYAEQIKEASAQMERLRQDLVDSPGPNSNGKAA* |
Ga0181521_104373992 | 3300014158 | Bog | IETNASLLLQNYGGFLPRQGHEYAERIREASAQMERLRQDLVGSAGCNSDEKAA* |
Ga0182024_105433863 | 3300014501 | Permafrost | YGGFLPKQGHEYAEQIKEASAEMEQLRQDLVGAPCGNGDQKAA* |
Ga0157379_100983451 | 3300014968 | Switchgrass Rhizosphere | RQGHEYAEQIKEASIQMERLRQDLVASPGHDSDERAA* |
Ga0132255_1053223162 | 3300015374 | Arabidopsis Rhizosphere | RLLLQNYGGFLPRQGHEYAEQIREASAQMERLRQDLVGSPDSDNNENAEYDSVA* |
Ga0182032_114892661 | 3300016357 | Soil | GLILQNYGGFLPRQGQKYAENIKEASAQMEQLRQDLVGGPASSSDEKAAYDAVA |
Ga0187819_104553631 | 3300017943 | Freshwater Sediment | LENYGGFLPRQGHEYAEQIKEAAAQMERLRLDLLGRPLSNTGEKAA |
Ga0187781_100000191 | 3300017972 | Tropical Peatland | LQNYGGFLPRQGHAYAEQIKEASAQMERLRQDLLNGSGKSNDAKPVYESVA |
Ga0187782_103656901 | 3300017975 | Tropical Peatland | NYGGFLPRQGHEYAEQIKEASARMERLRQDLVGGPGSTIDEKHTFDA |
Ga0187888_12106681 | 3300018008 | Peatland | NASLLLQNYGGFLPRQGHEYAEQIREASAQMERLRQDLVGSAGCNTDEKAA |
Ga0187875_101857131 | 3300018035 | Peatland | NASLLLQNYGGFLPRQGHEYAERIREASAQMERLRQDLVGSAGCNSDEKAA |
Ga0187859_103000841 | 3300018047 | Peatland | RQGHEYAEQIKEASAQMELLRQDLVGSTNSYRDKKAA |
Ga0187765_109563311 | 3300018060 | Tropical Peatland | GHEYAEQIKEASAQMERLRQDLVGSLGSNIDEKGTCDSVA |
Ga0187771_104555241 | 3300018088 | Tropical Peatland | RQGYEYAEQIREASAQMERLRQDLVGSSGSNSDEQAA |
Ga0066655_100966541 | 3300018431 | Grasslands Soil | QNYGGCLTQQGNEYAEQIKEASAQMERLRQDLVDNPGSNSDQKVA |
Ga0066655_105802031 | 3300018431 | Grasslands Soil | RQGHEYAEQIKEASIQMERLRQDLVASPGRNGDGKAA |
Ga0066669_118263731 | 3300018482 | Grasslands Soil | RQGHEYAEQIREASAQMERLRQDLVGSSASNSDEKAA |
Ga0210399_103717323 | 3300020581 | Soil | NTSAIESNASLLLQNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVACNGANGEVKAA |
Ga0210401_103350941 | 3300020583 | Soil | KTSAIEANARLLLDNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGRNSDDMAAA |
Ga0210401_103906223 | 3300020583 | Soil | NYGDFLPWQGHEYAEQMNEAAVQMELLRQDLVSSRAS |
Ga0210408_110752981 | 3300021178 | Soil | SRLLLENYGGFLPRQGHEYAEQMKEAAAQMEQLRQDLVGSPGSASDVQAA |
Ga0210383_101225961 | 3300021407 | Soil | HGQEYAEQIKEAAAQVEHLRQDLVGSRDSKSEAKAA |
Ga0210383_117925182 | 3300021407 | Soil | IIAINMNSRLLLENYGGFLPRQGHEYAEQMNEAAAQMERLRQDLVGRQVSASDENAA |
Ga0210394_100498616 | 3300021420 | Soil | RQGHEYAEQMNEAAAQMEVLRQDLVGSPPSNGNERAA |
Ga0242669_10346871 | 3300022528 | Soil | SAIEANASLLLENYGGFLPRQGHEYAEQIREASAQMERLRQDLVASSDERAA |
Ga0242660_12148591 | 3300022531 | Soil | YGGFLPRQGHEYAEQIKEASAEMERLRQDLVGRPGANGDEKAA |
Ga0242662_101065721 | 3300022533 | Soil | ARSNTSAIEANASLLLENYGGFLPRQGHEYAEQIREASAQMERLRQDLVASSDERAA |
Ga0212123_107991962 | 3300022557 | Iron-Sulfur Acid Spring | PRQGHEYAEQMNEAAAQMERLRQDLVGSQVSTSDENAA |
Ga0207672_10088121 | 3300025223 | Corn, Switchgrass And Miscanthus Rhizosphere | NSRLLLQNYGGFLPRQGHKYAEQIREASAQMERLRQDLVGNPDSDNDEKAAYDSVA |
Ga0208194_10569451 | 3300025412 | Peatland | QNYGGFLPRQGHEYAEQIREASAQMERLRQDLVGSAGCNTDEKAA |
Ga0208188_10478581 | 3300025507 | Peatland | NYGGFLPRQGHEYAERIREASAQMERLRQDLVGSAGCNSDEKAA |
Ga0207696_11438252 | 3300025711 | Switchgrass Rhizosphere | QGHKYAEQIREASAQMERLRQDLVGNPDSDNDEKAAYDSVA |
Ga0207642_107548972 | 3300025899 | Miscanthus Rhizosphere | AIEANARLLLDNYGGFLPRQGHEYAEQIKEASIQMEQLRQDLVASPDRNSGEKAA |
Ga0207699_107890762 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AIEANARLLLENYGGFLPRQGHEYAEQIQEASIQMERLRQDLVASPGSNCNGKAA |
Ga0207671_112311142 | 3300025914 | Corn Rhizosphere | NARLLLDNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPSHTGDEKAA |
Ga0207646_115894901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SAIEANARLLLDNYGGFLPRQGHEYAEQIKEASIQMEQLRQDLVASPDRNRDAKAA |
Ga0207687_108861443 | 3300025927 | Miscanthus Rhizosphere | YGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPSHTGDEKAA |
Ga0207669_119316642 | 3300025937 | Miscanthus Rhizosphere | SKTSAIEANARLLLDNYGGFLPRQGHEYAEQIKEASIQMEQLRQDLVASPDRNSGEKAA |
Ga0207712_108125772 | 3300025961 | Switchgrass Rhizosphere | LPRQGHEYAEQIKEASAQMERLRQDLVGSPTSTDEEAVYDSVA |
Ga0257180_10274711 | 3300026354 | Soil | RLLLENYGGFLPRQGHEYAEQMKEAAAQMERLRQDLVGNRGSESDEKAA |
Ga0208368_1050842 | 3300027161 | Forest Soil | KSARLLLQNYGGFLPLQGQKYAEQIEEASAQMEQLRQDLVGSPGFKTDEIVAYDSVA |
Ga0209213_10773571 | 3300027383 | Forest Soil | RLLLENYGGFLPRQGHEYAEQMKEAAAQMEQLRLDLVGSRGSNGDGKAA |
Ga0209735_10910461 | 3300027562 | Forest Soil | RLLLENYGDFLPRQGHEYAEQMNEAAAQMERLRQDLVGSQVSTSDENAA |
Ga0209625_11593242 | 3300027635 | Forest Soil | IEANASLLLENYGGFLPRQGHEYAEQIREASAQMERLRQDLVASSDERAA |
Ga0209580_103864101 | 3300027842 | Surface Soil | QGQKYAEQIEEASAQMEQLRQDLVGSPGFKTDEIVAYDSVA |
Ga0268264_113525422 | 3300028381 | Switchgrass Rhizosphere | ANARLLLDNYGGFLPRQGHEYAEQIKEASIQMERLRQDLVASPGHDSDERAA |
Ga0137415_104252731 | 3300028536 | Vadose Zone Soil | RQGHEYAEQIKEASAQMEQLRQDLVASPDCKSDAKAA |
Ga0302222_100943273 | 3300028798 | Palsa | LPRQGHEYAEQMKEAATQMERLRQDLIGRPGSEREEKAA |
Ga0310038_101793264 | 3300030707 | Peatlands Soil | RQGHEYAEQIKEASAQMERLRQDLVGTPGSNNDEKAAYDSVA |
Ga0265460_121921841 | 3300030740 | Soil | LLLENYGDFLPRQGHEYAEQMNEAAAQMERLRQDLVGSQVSASDENAA |
Ga0073994_124244171 | 3300030991 | Soil | IEGNARLLLENYGGFLPRHGHEYAEQIRKSAAQMERLRQDLLSGPSPNGDEKAA |
Ga0170834_1013638292 | 3300031057 | Forest Soil | GHEYAEQIKEASAQMEQLRQDLVGGQGSNGDEKAA |
Ga0170824_1207018761 | 3300031231 | Forest Soil | SRLLLENYGGFLPRQGHEYAEQMKEAAAQMELLRQDLVGSPGSGSDEIAA |
Ga0307476_108430143 | 3300031715 | Hardwood Forest Soil | VAINMNSRLLLENYGDFLPWQGHEYAEQMNEAAVQMELLRQDLVSSRAS |
Ga0307477_107476891 | 3300031753 | Hardwood Forest Soil | ENYGGFLPRQGHEYAEQMNEAAAQMERLRQDLVGSRVSGSDERAA |
Ga0307475_114794891 | 3300031754 | Hardwood Forest Soil | LLLQNYGGFLPRQGHEYAEQIQEASAQMERLRQDLVGGTGSNGDERAA |
Ga0310912_101748701 | 3300031941 | Soil | AEQIKEASAEMERLRQDLVGGPVAVNVQEEEPAFDA |
⦗Top⦘ |