Basic Information | |
---|---|
Family ID | F097778 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 41 residues |
Representative Sequence | HELATQLGTVLEWQAGGRSFVLAGSLPPAAAEAAARELK |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.154 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 25.37% Coil/Unstructured: 58.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 89.42 |
PF12730 | ABC2_membrane_4 | 2.88 |
PF13374 | TPR_10 | 0.96 |
PF09754 | PAC2 | 0.96 |
PF01987 | AIM24 | 0.96 |
PF14579 | HHH_6 | 0.96 |
PF04228 | Zn_peptidase | 0.96 |
PF07991 | IlvN | 0.96 |
PF12399 | BCA_ABC_TP_C | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.92 |
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.96 |
COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.96 |
COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.54% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_04500090 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MTGVAARSLDGVTAHELATPLGTVLGWRSGGTSTCSPDPVPPAAAEAAAQAVK |
Ga0066677_104471592 | 3300005171 | Soil | GLTGHELATQLGTAIEWTRNGVSFVLAGSLPPAAAESAARALK* |
Ga0066683_101231961 | 3300005172 | Soil | TAHELATQLGTAITWNSGGTSYLLAGSLPPAAAEAAARAVK* |
Ga0066678_110322231 | 3300005181 | Soil | HELATQLGTVLGWQRNGVDFVLAGSLPPAAAETAARDLGK* |
Ga0066675_112716952 | 3300005187 | Soil | TLDGVTAHELTTQLGTILTWDRGSVSYVLAGSVPSSAAEAAARALK* |
Ga0070673_1014652601 | 3300005364 | Switchgrass Rhizosphere | SISLDGATAHELATQLGTVLTWDRAGVSYVLAGSVPSSAAEAAARALR* |
Ga0070706_1018054012 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HELATQLGTVLTWDRSGVSYVLAGSLPPAAAEAAARSLK* |
Ga0070707_1003876603 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TAHELATQLGTVLEWQEGGRSFVLGGSLPPAAAESAARELK* |
Ga0070741_100181081 | 3300005529 | Surface Soil | ELATQLGTVLEWQRGGTSFLLAGSLPPAAAESAARELG* |
Ga0070741_104378991 | 3300005529 | Surface Soil | LSTQLGTILTWDKGGVTYVLAGSVPSAAAEAAARAIG* |
Ga0066701_100662781 | 3300005552 | Soil | HELATQLGTVLEWQQGGRSFVLAGSLPPAAAESAARELK* |
Ga0066692_102116211 | 3300005555 | Soil | LPSVSLDGVTAHELATQLGTVLGWDRGGVSYVLAGSIPTAAAESAARSLK* |
Ga0066692_104230612 | 3300005555 | Soil | LNGVTAHELATQLGTVLEWQQGGRSFVLAGSLPPAAAESAARELK* |
Ga0066704_106686422 | 3300005557 | Soil | LDGLTGHELATQLGTAIQWRRNGVSFILAGSLPPAAAESAARALK* |
Ga0066706_109701732 | 3300005598 | Soil | GHELATQLGTAIEWQRNGVSFVLAGSLPPAAAESAARALK* |
Ga0075292_10489071 | 3300005887 | Rice Paddy Soil | STQLGTILTWRRAGVDFVLAGSQPAAAAEAAARVLG* |
Ga0070717_117391632 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LATQLGTVLEWQRDGTAYVLAGSLPAAAGEAAARQLK* |
Ga0075028_1002997401 | 3300006050 | Watersheds | LATALGTVIEWKNGGVDYVLAGSLPSAAAEAAARTLK* |
Ga0070712_1012641592 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TAHELATQLGTVLEWQSQGTGFVLAGSLPPAAAEAAARAVK* |
Ga0074060_119438721 | 3300006604 | Soil | VSLDGLTGHELATQLGTAIEWQRNGVSFVLAGSLPPAAAESAARALR* |
Ga0074062_124974662 | 3300006606 | Soil | VSLNGVTAHELATQLGTVIEWQQGGHSFVLAGSLPPTAAEAAARELK* |
Ga0075433_106182572 | 3300006852 | Populus Rhizosphere | TAHELSTQLGTILTYRDGDVDYVVAGSVPRSAAEAAARQLR* |
Ga0075425_1021226252 | 3300006854 | Populus Rhizosphere | TQLGTALQWRRRGVEFVLAGSVPPAAAEAAARDLR* |
Ga0075434_1012560442 | 3300006871 | Populus Rhizosphere | AHEFATQLGTIVTWQRAGVSTTLAGSVPAAAAEAAARELR* |
Ga0075424_1005572841 | 3300006904 | Populus Rhizosphere | ATQLGTLLAWQANGTAYVLGGSLPPAAAEAAARALR* |
Ga0066709_1012525692 | 3300009137 | Grasslands Soil | VTAHELATQLGTVLGWERGGVQFVLVGSLPSAAAESAARTLK* |
Ga0111538_119696101 | 3300009156 | Populus Rhizosphere | SAHELSTQLGTLIQWQRGGTSYVVAGSMPAAAAEAAARQLK* |
Ga0105242_132242451 | 3300009176 | Miscanthus Rhizosphere | TQLGTVVEWQRGGVAFVLAGSVPSATAETAARNFT* |
Ga0134063_105753952 | 3300010335 | Grasslands Soil | VALGSATGHELATELGTVLLFDRAGVTFVLAGSMPPAAPEAAARGLLG* |
Ga0126383_125481752 | 3300010398 | Tropical Forest Soil | TQLGTILEWQRDGVAFVLAGSLPPAAAETAARELE* |
Ga0126348_11656491 | 3300010862 | Boreal Forest Soil | ITGLPTVSLNGVTAHELATQLGTVVEWSQGGTGFVLAGSLPPAAAESAARELK* |
Ga0120164_10465931 | 3300011987 | Permafrost | LDGVTGHELATQLGTIIQWERGGVSYVLAGSLPPAAAQEAARNLK* |
Ga0120162_100007248 | 3300011997 | Permafrost | LAGVTAHELATQLGTVLGWDSGQVSFVLAGSLPSGAAEAAARALK* |
Ga0137381_104179343 | 3300012207 | Vadose Zone Soil | HELATQLGTVLEWQAGGRSFVLAGSLPPAAAEAAARELK* |
Ga0137376_103634303 | 3300012208 | Vadose Zone Soil | LNGVTAHELATQLGTVLEWQAGGRSFVLAGSLPPAAAESAARELK* |
Ga0137384_108098831 | 3300012357 | Vadose Zone Soil | TELGTVLAWDRGGVSYILAGSVPSAAAEAAARGLK* |
Ga0157315_10094541 | 3300012508 | Arabidopsis Rhizosphere | AHELATQLGTVLSWQANGTAFVLGGSLPPAAAEAAARALR* |
Ga0157326_10370891 | 3300012513 | Arabidopsis Rhizosphere | ITAHELATQLGTVLSWQANGTAFVLGGSLPPAAAEAAARALR* |
Ga0137398_106732421 | 3300012683 | Vadose Zone Soil | TQLGTVVEWSQSGTGFVLAGSLPPAAAESAARELK* |
Ga0137394_100835381 | 3300012922 | Vadose Zone Soil | GHELATQLGTAIEWQRNGVSFVIAGSLPPAAAESAARALK* |
Ga0137359_111678792 | 3300012923 | Vadose Zone Soil | LATQLGTVIEWQHSGVAYVLAGSLPPAAAEAAARELK* |
Ga0164298_109859891 | 3300012955 | Soil | TQLGTVLEWQAGGRSFVLAGSLPPAAAESAARELK* |
Ga0164299_104231842 | 3300012958 | Soil | QELATQLGTVLTWKRGEVAYVLAGSMPPAAAEAAARGLG* |
Ga0126369_106532453 | 3300012971 | Tropical Forest Soil | ENVLTNLPEVSLGGISAHELSTQLGTILAWRQGGVESVLVGSVPAATAEAAARELAP* |
Ga0134087_104118101 | 3300012977 | Grasslands Soil | QLGTVVTWQRDGVGYVLAGSLPPAAAEAAARDLK* |
Ga0134087_104590771 | 3300012977 | Grasslands Soil | ELATQLGTVLEWQEGGRAFVLAGSLPPAAAESAARELK* |
Ga0164304_115050922 | 3300012986 | Soil | SLGGTTAHELSTQLGTVLGWDEGQVSFVLAGSLPSGAAESAARALR* |
Ga0164305_113921922 | 3300012989 | Soil | SLSGITAHELVTQLGTVLTWDRGGVTYILAGSLPSGAAEAAATAIG* |
Ga0163162_124096961 | 3300013306 | Switchgrass Rhizosphere | ATQLGTALQWRRRGVEFVLAGSVPPAAAEAAARDLR* |
Ga0137409_110510231 | 3300015245 | Vadose Zone Soil | QLGTVLFFDRNRVSFVLAGSMPPTAAEMAARSLG* |
Ga0137403_106709541 | 3300015264 | Vadose Zone Soil | VTAHELATQLGTVVEWSQGGTGFVLAGSLPPAAAESAARELK* |
Ga0132256_1006276533 | 3300015372 | Arabidopsis Rhizosphere | GVTAHELATQLGTVLEWQRDGTSYVVAGSLPAAAAEAAGRQLLK* |
Ga0134074_11562401 | 3300017657 | Grasslands Soil | LATQLGTVLTWKRGEVAYVLAGSVPPAAAEAAARALG |
Ga0187785_105964972 | 3300017947 | Tropical Peatland | ITAHELATQLGTAIEWHEGGTAYVLAGSLPPAAAEAAARQLK |
Ga0187776_112847552 | 3300017966 | Tropical Peatland | ELATQLGTILTWQAGGTSFVLAGSLPASAAETAARAVK |
Ga0187780_106471842 | 3300017973 | Tropical Peatland | VTAHELPTQLGTVLGWDRGDVSFVLAGSVPTSAAEAAARALG |
Ga0187773_111093081 | 3300018064 | Tropical Peatland | HELSTQLGTVLQWNAGGTNFVLAGSLPAAAAETAARAVK |
Ga0066667_111148801 | 3300018433 | Grasslands Soil | TVARDGWTGHELATQLGTAIQWTRDGVSYVLVGSLPPAAAESAARALK |
Ga0066667_112701672 | 3300018433 | Grasslands Soil | AVTLDGVTAHELATQLGTILTWDNGNVTYLLAGSVPSSAAEAAARALK |
Ga0066667_114949922 | 3300018433 | Grasslands Soil | ATQLGTVVLFQQAGVSYVLAGSLPPAAAEAAARALQ |
Ga0066667_120600621 | 3300018433 | Grasslands Soil | HELATQLGTVLEWQRGGVDYVLAGSLPPGAAEAAARALR |
Ga0066662_114076991 | 3300018468 | Grasslands Soil | TAHELATQLGTVLEWQTGGTSYVLAGSLPTAAAEAAARAVK |
Ga0193699_101777021 | 3300021363 | Soil | LATQLGTVLTWDRAGVTYVLAGSLPSSAAEAAATAIG |
Ga0210397_115121591 | 3300021403 | Soil | GVTAHEVSTQLGTVLSWDRGGVTYVLAGSVATTAAESAARALG |
Ga0247661_10670332 | 3300024254 | Soil | HELATQLGTALTWRKGGVSFVLAGSVPPAAAEAAARALG |
Ga0208078_10186153 | 3300025544 | Arctic Peat Soil | TQLGTVLEWQQGGRSLVLAGSLPPAAAESAARELK |
Ga0207699_112269312 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TQLGTVLTWKRGEVDYVLAGSVPPAAAEAAARALG |
Ga0207663_115431011 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TQLGTAIQWTRDGVSFVLVGSLPPAAAESAARALK |
Ga0207663_117234332 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ATQLGTVLTWDRACVTYVLAGSLPPAAAEAAARSLR |
Ga0207646_101705313 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ATQLGTVIAWQREGVAYVLAGSLPPAAAEAAARNLK |
Ga0207700_103767311 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LDGLQGHELATQLGTAIQWTRNGVSFVLVGSLPPAAAESAARALK |
Ga0207700_111204591 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LATQLGTVLEWQSQGTGFVLAGSLPPAAAEAAARAVK |
Ga0207700_119829422 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DGVTAHELSTQLGTVLSWDAGQASYVLAGSLPSGAAESAARALK |
Ga0207664_112095632 | 3300025929 | Agricultural Soil | ATQLGTILTWDAGGVSYVLAGSVPAAAAESAARALR |
Ga0207665_105960731 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TGHELATQLGTILTWDRGGVSYILAGSVPSSAAEAAARGL |
Ga0207661_106277461 | 3300025944 | Corn Rhizosphere | YELSTQLGTILSWDSGGVSYVLAGSVPATAAESAARTLK |
Ga0209801_11330371 | 3300026326 | Soil | ATQLGTALEWQRNGVSFVLAGSLPPAAAESAARSLK |
Ga0209804_12705801 | 3300026335 | Soil | GLPTVSLDGLTGHELATQLGTAIEWTRNGVSFVLAGSLPPAAAESAARALK |
Ga0209808_11932082 | 3300026523 | Soil | LPTVSLNGVTAHELATQLGTVLEWQEGGRAFVLAGSLPPAAAESAARELK |
Ga0209059_10309292 | 3300026527 | Soil | VTAHELATQLGTVLQWQDAGTSIVLAGSLPSAAAEAAARQLK |
Ga0209073_103932142 | 3300027765 | Agricultural Soil | HELATQLGTAIEWKRNGVAFVLVGSLPPAAAESAARALK |
Ga0209465_105403072 | 3300027874 | Tropical Forest Soil | ELATQLGTALQWRRAGVEYVLAGSVPAAAAEAAARDLR |
Ga0207428_101596593 | 3300027907 | Populus Rhizosphere | IDGLTAHELATQLGTVIAWQSGGTSFVLAGSRARAAAVAAARALK |
Ga0307292_104635992 | 3300028811 | Soil | KVSLDGVTGHELATELGTALRWERDGVGYVLAGSLPASAAEAAARSLK |
Ga0307312_101662601 | 3300028828 | Soil | TQLGTLIEWQRGGVTFVLAGSVPSAKAETAARDVQ |
Ga0311336_107243852 | 3300029990 | Fen | TQLGTIVTWQHAGVSTTLAGSIPSAAAEAAARELG |
Ga0307468_1010638682 | 3300031740 | Hardwood Forest Soil | DGLKGHELATQLGTAVQWTRNGVSFVLAGSLPPAAAESAARALK |
Ga0318517_100174521 | 3300031835 | Soil | TQLGTILAWQSGGTSFVLAGSQPAAAAEAAARAVK |
Ga0318512_107291571 | 3300031846 | Soil | LDGVSAHELATELGTVLQWQSGGTTFVLAGSQPPAAAEAAARAVK |
Ga0318536_105459422 | 3300031893 | Soil | LPTVSLDGLTAHELATQLGTVLEWQSGGTSYVLAGSLPASATETAARAVK |
Ga0318520_103157551 | 3300031897 | Soil | AHELATQLGTVLEWESNGTRFILAGSLPASAAEAAARDVK |
Ga0318520_108022371 | 3300031897 | Soil | LPTVSLDGLTAHELSTQLGTVLAWDAGGTSFVLAGSLPASAAEAAARAVK |
Ga0308175_1021342011 | 3300031938 | Soil | LSGITAHELATQLGTVLTWDRGGVSYILAGSLPSSAAEAAAAAIG |
Ga0308174_115001652 | 3300031939 | Soil | VTAHELATQLGTVLGWNRAGVTYVLAGSIPSSAAEAAARALR |
Ga0318563_103942371 | 3300032009 | Soil | TQLGTVLEWESNGTRFILAGSLPASAAEAAARDVK |
Ga0318507_102021102 | 3300032025 | Soil | LTAHELATQLGTILAWQSGGTSFVLAGSQPAAAAEAAARAVK |
Ga0318559_105804152 | 3300032039 | Soil | TFSVNGVTAHELATQLGTVLTWDKGGVTYILAGSVPSSAAEAAATALTK |
Ga0318553_103765521 | 3300032068 | Soil | SLDGVSAHELATELGTVLQWQSGGTTFVLAGSQPPAAAEAAARAVK |
Ga0306924_123666442 | 3300032076 | Soil | TVHELATQLGTVLDWSSGGASFVLAGSLSAADAEAAARTVK |
Ga0318525_102686811 | 3300032089 | Soil | GLTAHELATQLGTILAWQSGGTSFVLAGSQPAAAAEAAARAVK |
Ga0307472_1004751551 | 3300032205 | Hardwood Forest Soil | VSLDGLTGHELATQLGTALEWQRNGVSFVLAGSLPPAAAESAARSLK |
Ga0306920_1023811242 | 3300032261 | Soil | DGLTAHELATQLGTALEWQSGGTSYVLAGSLPAAAAEAAARAVR |
Ga0314868_013822_2_136 | 3300033758 | Peatland | NGITAHELATQLGTAIEWHDGGTAYVLAGSLPPAAAEAAARQLK |
Ga0372943_0974578_423_563 | 3300034268 | Soil | SLDGVTAHELSTQLGTALAWDRGGVSYVLAGSVPSSAAEAAARSLK |
⦗Top⦘ |