NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097724

Metagenome / Metatranscriptome Family F097724

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097724
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 78 residues
Representative Sequence MARKALSLLLPASVAVLAASQWREISRYLKLRQMSSGGGHPENVPVEGHHSYPKAPGGGVPDGTGDFDSGSRGGGPVSA
Number of Associated Samples 85
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.81 %
% of genes near scaffold ends (potentially truncated) 25.00 %
% of genes from short scaffolds (< 2000 bps) 77.88 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.731 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(31.731 % of family members)
Environment Ontology (ENVO) Unclassified
(28.846 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.654 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 35.51%    β-sheet: 0.00%    Coil/Unstructured: 64.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00248Aldo_ket_red 24.04
PF00291PALP 20.19
PF08044DUF1707 8.65
PF12840HTH_20 2.88
PF01266DAO 1.92
PF03551PadR 1.92
PF00271Helicase_C 1.92
PF12029DUF3516 1.92
PF13649Methyltransf_25 0.96
PF01425Amidase 0.96
PF08220HTH_DeoR 0.96
PF00171Aldedh 0.96
PF00270DEAD 0.96
PF05899Cupin_3 0.96
PF00255GSHPx 0.96
PF01061ABC2_membrane 0.96
PF08241Methyltransf_11 0.96
PF04149DUF397 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.92
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.92
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.92
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.96
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.96
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 0.96
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.96
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.73 %
UnclassifiedrootN/A18.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10114746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1911Open in IMG/M
3300005591|Ga0070761_10124276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1500Open in IMG/M
3300005602|Ga0070762_10301429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW141010Open in IMG/M
3300005712|Ga0070764_10035837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2512Open in IMG/M
3300005921|Ga0070766_10244088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1137Open in IMG/M
3300005921|Ga0070766_10888870Not Available610Open in IMG/M
3300005952|Ga0080026_10019885Not Available1629Open in IMG/M
3300006176|Ga0070765_100247063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1635Open in IMG/M
3300006893|Ga0073928_10415595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii981Open in IMG/M
3300009029|Ga0066793_10218981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus1106Open in IMG/M
3300009638|Ga0116113_1144649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces himastatinicus → Streptomyces himastatinicus ATCC 53653593Open in IMG/M
3300009665|Ga0116135_1368130Not Available578Open in IMG/M
3300010343|Ga0074044_10223532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300010859|Ga0126352_1118389Not Available539Open in IMG/M
3300010866|Ga0126344_1185366All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300010866|Ga0126344_1443980Not Available526Open in IMG/M
3300010869|Ga0126359_1354981Not Available505Open in IMG/M
3300010876|Ga0126361_10006189Not Available1289Open in IMG/M
3300010876|Ga0126361_10034078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1123Open in IMG/M
3300010876|Ga0126361_10147433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300012205|Ga0137362_11026235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14702Open in IMG/M
3300014201|Ga0181537_10306129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1091Open in IMG/M
3300014492|Ga0182013_10000479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria56030Open in IMG/M
3300016404|Ga0182037_10296957All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300016445|Ga0182038_11213809Not Available673Open in IMG/M
3300017946|Ga0187879_10727531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces apricus553Open in IMG/M
3300017948|Ga0187847_10129032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1385Open in IMG/M
3300018009|Ga0187884_10220642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14777Open in IMG/M
3300018019|Ga0187874_10399128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus555Open in IMG/M
3300018025|Ga0187885_10338940All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300018034|Ga0187863_10395711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300018037|Ga0187883_10064474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1928Open in IMG/M
3300018038|Ga0187855_10029758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3500Open in IMG/M
3300018042|Ga0187871_10228781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300018043|Ga0187887_10109240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1664Open in IMG/M
3300018044|Ga0187890_10349958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria828Open in IMG/M
3300018046|Ga0187851_10539960All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300018060|Ga0187765_10395088Not Available853Open in IMG/M
3300021180|Ga0210396_10626403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae934Open in IMG/M
3300021180|Ga0210396_10701243Not Available874Open in IMG/M
3300021181|Ga0210388_10129339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2182Open in IMG/M
3300021406|Ga0210386_10020161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5196Open in IMG/M
3300023101|Ga0224557_1000077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia107404Open in IMG/M
3300025625|Ga0208219_1004075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5056Open in IMG/M
3300026214|Ga0209838_1014897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1075Open in IMG/M
3300026294|Ga0209839_10002302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9364Open in IMG/M
3300027158|Ga0208725_1014769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1286Open in IMG/M
3300027692|Ga0209530_1044469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1307Open in IMG/M
3300027692|Ga0209530_1059698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1109Open in IMG/M
3300027853|Ga0209274_10248579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300027908|Ga0209006_10361904Not Available1227Open in IMG/M
3300027908|Ga0209006_10385326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae1183Open in IMG/M
3300028742|Ga0302220_10075287Not Available1362Open in IMG/M
3300028747|Ga0302219_10389774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus545Open in IMG/M
3300028773|Ga0302234_10109780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1211Open in IMG/M
3300028780|Ga0302225_10045434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2181Open in IMG/M
3300028781|Ga0302223_10117711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales879Open in IMG/M
3300028789|Ga0302232_10005583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8073Open in IMG/M
3300028789|Ga0302232_10106122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1436Open in IMG/M
3300028789|Ga0302232_10115034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1370Open in IMG/M
3300028789|Ga0302232_10129345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1281Open in IMG/M
3300028806|Ga0302221_10042458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2113Open in IMG/M
3300028808|Ga0302228_10045058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2143Open in IMG/M
3300028863|Ga0302218_10176515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus680Open in IMG/M
3300028877|Ga0302235_10095472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes1357Open in IMG/M
3300028877|Ga0302235_10189265Not Available909Open in IMG/M
3300028879|Ga0302229_10159124Not Available1044Open in IMG/M
3300028879|Ga0302229_10315700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae701Open in IMG/M
3300028906|Ga0308309_10018778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4523Open in IMG/M
3300029882|Ga0311368_10865983Not Available609Open in IMG/M
3300029882|Ga0311368_11037786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14538Open in IMG/M
3300029910|Ga0311369_10141803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2333Open in IMG/M
3300029910|Ga0311369_11278645Not Available562Open in IMG/M
3300029943|Ga0311340_10045680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae5234Open in IMG/M
3300029943|Ga0311340_11400072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces apricus552Open in IMG/M
3300029951|Ga0311371_10721076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1248Open in IMG/M
3300030013|Ga0302178_10041218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2597Open in IMG/M
3300030043|Ga0302306_10130735Not Available970Open in IMG/M
3300030053|Ga0302177_10003016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11813Open in IMG/M
3300030058|Ga0302179_10037921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales2214Open in IMG/M
3300030399|Ga0311353_10262581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1596Open in IMG/M
3300030490|Ga0302184_10112304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes1218Open in IMG/M
3300030677|Ga0302317_10298522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus722Open in IMG/M
3300030739|Ga0302311_10708037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus664Open in IMG/M
3300030740|Ga0265460_12251466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus574Open in IMG/M
3300030743|Ga0265461_11789853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14687Open in IMG/M
3300030743|Ga0265461_13440218Not Available535Open in IMG/M
3300030840|Ga0074020_11105102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300030877|Ga0265777_117831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus569Open in IMG/M
3300031090|Ga0265760_10261025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14603Open in IMG/M
3300031236|Ga0302324_100212005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3075Open in IMG/M
3300031525|Ga0302326_11694067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14834Open in IMG/M
3300031708|Ga0310686_105436788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2652Open in IMG/M
3300031708|Ga0310686_106851142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5073Open in IMG/M
3300032515|Ga0348332_10099151Not Available1079Open in IMG/M
3300032515|Ga0348332_10710079All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300032739|Ga0315741_11863223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus530Open in IMG/M
3300032756|Ga0315742_12057577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14638Open in IMG/M
3300032756|Ga0315742_12862990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus siccus555Open in IMG/M
3300032783|Ga0335079_10339852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1630Open in IMG/M
3300032897|Ga0335071_10416809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1296Open in IMG/M
3300032955|Ga0335076_10349645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1364Open in IMG/M
3300033134|Ga0335073_10085007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4123Open in IMG/M
3300034163|Ga0370515_0005299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6351Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa31.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.69%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil6.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.92%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.96%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.96%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.96%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.96%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030877Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1011474623300001593Forest SoilMARKALSLLLPASVAVLAATQWQEITRYLKLRQMSSGGGHPENVPVEGHHAYPKAPGGGVPDGTGDFDSGSRGGGPVSA*
Ga0070761_1012427623300005591SoilMARKALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPVSA*
Ga0070762_1030142923300005602SoilMASKALLLLLPASVAVAVASQWREISRYVKMERMSSGGGHPENVPVEGVHAYPSPGAGEPDGTGEFDSGSRGGPQTALVLHA*
Ga0070764_1003583733300005712SoilMARRALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSA*
Ga0070766_1024408823300005921SoilMARRALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSASRGGGPVS*
Ga0070766_1088887013300005921SoilMARKALSVLLASVAVLAVSQWQEIVRYVKIKQMSEGDGHPQDVPAEGQHAYPKPSGGVPDGTGDFDSASRGGPDLNP*
Ga0080026_1001988523300005952Permafrost SoilMARKALFLLPAFAAVLAASQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPSSSGGGAADGTGDFDSGSRGGPATP*
Ga0070765_10024706323300006176SoilMARRALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVTA*
Ga0073928_1041559523300006893Iron-Sulfur Acid SpringMVRKALLLLVPAAAMAAAVASQWREINRYLKLEQMSSGSGHPHTVPVEGSHAYPPPGRGALDGTGEFDSGSRGGPVDAPPGPRQPGSRRGI*
Ga0066793_1021898123300009029Prmafrost SoilMARKALFLLPAFAAVLAASQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPTSPGGGAADGTGDFDSGSRGGPATP*
Ga0116113_114464913300009638PeatlandMARKALFLLPVFAGVLAASQWRELSRYIKLRQMSSGGGHPESVPVEGHHSYPTGPGGGVADGTGDFDSLSRGGGPVS*
Ga0116135_136813023300009665PeatlandMARKALSLLLPVSVAVLAASQWRELSRYVKLRQMSSGDGHPEHVPVEGHHSYPKGPGGGVPDGTGDFNSASRGGGPVSA*
Ga0074044_1022353223300010343Bog Forest SoilMARKALLLLVPAVAVAVASRWREISRYLKVSRMSSGDGHPENVPVEEVQAYPAPGRGHSHRNGEFDSGSRGGPNLA*
Ga0126352_111838913300010859Boreal Forest SoilMARKALLLLPVSVAVLAASQWRELSRYVKLRQMSSGGGHPENVPVEGNHSYPSSPGGGAADGTGDFDSGSRGGPQTP*
Ga0126344_118536623300010866Boreal Forest SoilRKALLLLVPVTVAAAVASQWREISRYLKVSQMSSGAGNPQVVPVHGVQGYEHPGGGDSDGTGQFDSASRGGGPVA*
Ga0126344_144398013300010866Boreal Forest SoilMARKALLLLPVSVAVLAASQWRELSRYVKLRQMSSGGGHPESVPVEGIHAYPSSPGGGAADGTGDFDSGSRGGPQNP*
Ga0126359_135498113300010869Boreal Forest SoilMARKVLFLLPVVAAALAASQWQELSRYIKLRQMSSGGGHPENVPVEGSHAYPTSPGGGAADGTGDFDSLSRGGGPVRA*
Ga0126361_1000618923300010876Boreal Forest SoilMARKVLLLLVPATVAAAVASQWREISRYLKVSQMSSAAGNPQIVPVHGVQGYEHPGGGDSDGTGQFDSASRGGGPVA*
Ga0126361_1003407823300010876Boreal Forest SoilMARKALFLLPAFAAVLAASQWRELNRYVKLRQMSSGTGHPEHVPVEGHHSYPTSPGGGVPDGTGDFDSGSRGGPQTP*
Ga0126361_1014743323300010876Boreal Forest SoilMMARKALFLLPVFAAVLAASQWREFSRYIKLRQMSSGGGHPENVPVEGHHSYPSGPGGGVADGTGDFDSLSRGGGPVS*
Ga0137362_1102623523300012205Vadose Zone SoilMARKALRLLLPASIAVLAASQWREITRYLKIEQMSRGGGHPHAVPAAGQQAYPKGPGGGAPDGTGDFDSASRGGPDHA*
Ga0181537_1030612913300014201BogMARKALSLLLPASVAVLAASQWREISRYLKLRQMSSGGGHPENVPVEGHHAYPKAPGGVPDGTGDFDSAS
Ga0182013_10000479173300014492BogMVRKALFLLPVFVAVLAASQWRELSRYVKLRQMSSGDGHPEHVPVEGHHSYPTSPGGGAADGTGDFDSGSRGGPQTP*
Ga0182037_1029695713300016404SoilMARKSLLLLPASVAVLAASQWREISRYIKIQQMSRGSGNPQVVPAAGQHAYPNHPGDGALDGTGDFDSASRGGPAS
Ga0182038_1121380913300016445SoilMARKALLLLPVSVAVLAASQWREISRYIKIQQMSRGSGNPQVVPAAGQHAYPNHPGDGALDGTGDFDSASRGGPAS
Ga0187879_1072753123300017946PeatlandMARKALSLLLPASVAVLAASQWRELSRYLKLRQMSSGDGHPESVPVEGHHSYPKGPGAGVPDGTGDFDSGARGGGPVSA
Ga0187847_1012903223300017948PeatlandMARKALSLLLPASVAVLAASQWREISRYLKLRQMSSGDGHPESVPVEGHHSYPKGPGAGVPDGTGDFDSGSRGGGPVSA
Ga0187884_1022064223300018009PeatlandMARKALSLLLPASVAVLAASQWRELTRYLKLRQMSSGSGHPENVPVEGHHSYPKAPGGGVPDGTGDFDSASRGGGPVSV
Ga0187874_1039912813300018019PeatlandMARKALSLLLPVSVAVLAASQWRELSRYVKLRQMSSGDGHPEHVPVEGHHSYPKAPGGGVPDGTGDFDSASRGGGPVSV
Ga0187885_1033894013300018025PeatlandMARKALSLLLPASVAVLAASQWRELTRYLKLRQMSSGSGHPENVPVEGHHSYPKAPGGGVPDGTGDFDSAS
Ga0187863_1039571123300018034PeatlandMARKALFLLPVFAGVLAASQWRELSRYIKLRQMSSGGGHPESVPVEGHHSYPTGPGGGVADGTGDFDSLSRGGGPVS
Ga0187883_1006447423300018037PeatlandMARKALSLLLPASVAVLAASQWWELSRYLKLRQMSSGSGHPENVPVEGHHSYPNAPGGGVPDGTGDFDSASRGGGPVSV
Ga0187855_1002975843300018038PeatlandMARKALSLLLPVSVAVLAASQWRELSRYVKLRQMSSGDGHPEHVPVEGHHSYPKGPGAGVPDGTGDFDSGSRGGGPVSA
Ga0187871_1022878133300018042PeatlandMARKALSLLLPASVAVLAATQWREISRYLKLRQMSSGDGHPESVPVEGHHSYPKGPGAGVPDGTGDFDSGSRGGGPVSA
Ga0187887_1010924023300018043PeatlandMARKALSLLLPVSVAVLAASQWRELSRYVKLRQMSSGDGHPEHVPVEGHHSYPTGPGGGVADGTGDFDSGSRGGPQTP
Ga0187890_1034995833300018044PeatlandLPASVAVLAASQWREISRYLKLRQMSSGDGHPESVPVEGHHSYPKGPGAGVPDGTGDFDSGSRGGGPVSA
Ga0187851_1053996023300018046PeatlandMARKALSLLLPASVAVLAASQWRELTRYLKLRQMSSGSGHPENVPVEGHHSYPKAPGGGVPDGTGDFD
Ga0187765_1039508823300018060Tropical PeatlandKALLIVPVSVAVLAASQWREISRYIKIQQMSRGGGNPQLVPAAGQHAYPNRPGAGEPDGTGEFDSASRGGPAL
Ga0210396_1062640313300021180SoilMARKALSVLLASVAVLAVSQWQEIACYVKIKQMSEGDGHPQDVPAEGQHAYPKPSGGVPDGTGDFDSASRGGPDLNP
Ga0210396_1070124313300021180SoilMARRALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSA
Ga0210388_1012933933300021181SoilMARKALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSA
Ga0210386_1002016133300021406SoilMASKALLLLVPAAAAAVVASQWREISRYLKVAQMSSGAGNPQVVPVHGVQGYEHPGGGDSDGTGQFDSPSRGGGPAA
Ga0224557_1000077683300023101SoilMVRKALFLLPVFVAVLAASQWRELSRYVKLRQMSSGDGHPEHVPVEGHHSYPTSPGGGAADGTGDFDSGSRGGPQTP
Ga0208219_100407543300025625Arctic Peat SoilMARKALLLLVPVTVAAAVASQWRELNRYIKVSQMSSGGGSGHPEYVPVEGIAAYATPGSGANDGTGEFDSGSRGGPADAPAGPRQPGARRRS
Ga0209838_101489713300026214SoilMARKALSLLLPASVAVLAASQWRELSRYVKLRQMSSGGGHPEHVPVEGHHSYPKGPGGGVPDGTGDFDSG
Ga0209839_1000230283300026294SoilMARKALFLLPAFAAVLAASQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPSSSGGGAADGTGDFDSGSRGGPATP
Ga0208725_101476913300027158Forest SoilQVKPNKRRFTVARKALLLLLPASVAVAVASQWREINRYLKVAQMSSGDGHPQNVPASGAPAYKHPGAGDSDGTGQFDSASRGGGPVA
Ga0209530_104446923300027692Forest SoilMARKALSLLLPASVAVLAATQWQEITRYLKLRQMSSGGGHPENVPVEGHHAYPKAPGGGVPDGTGDFDSGSRGGGPVSA
Ga0209530_105969823300027692Forest SoilMARKALLFLLPASVAVAVASQWREITRYVKVAQMSSGDGHPQNVPASGAQGYTHPGDGDSDGTGQFDSGSRGGPEPA
Ga0209274_1024857923300027853SoilMARKALSLLFPASVAVLAASQWREISRYLKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPVSA
Ga0209006_1036190423300027908Forest SoilMARKALSVLLASVAVLAVSQWQEIVRYVKIKQMSEGDGHPQDVPAEGQHAYPKPSGGVPDGTGDFDSASRGGPDLNP
Ga0209006_1038532623300027908Forest SoilMASKALLLLVPAAAAAVVASQWREISRYLKVAQMSSGGGNPQVVPVHGVQGYEHPGGGDSDGTGQFDSPSRGGGPAA
Ga0302220_1007528713300028742PalsaMARKALSLLLPASVAVLVASQWRELSRYLKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPASA
Ga0302219_1038977413300028747PalsaKRIMARKALSLLLPASVAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKGPGSGVPDGTGDFDSPSRGGGPVSE
Ga0302234_1010978023300028773PalsaMARKALSLLLPASVAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPASA
Ga0302225_1004543433300028780PalsaMARKALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSV
Ga0302223_1011771123300028781PalsaMARKALSLLLPASVAVLAATQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSV
Ga0302232_1000558373300028789PalsaMARKALSLLLPASVAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKGPGSGVPDGTGDFDSPSRGGGPVSE
Ga0302232_1010612213300028789PalsaMARKALGLLLPASVAVLAASQWREISRYLKLRQMSSGGGHPENVPVEGHHSYPKAPGGGVPDGTGDFDSGSRGGGPVSA
Ga0302232_1011503423300028789PalsaMARKALSLLLPASVAVLAVSQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPKGPGAGVPDGTGDFDSGSRGGGPVSA
Ga0302232_1012934523300028789PalsaMARKALSLLLPASVAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKAPGGGVPDGTGDFDSASRGGGPVSA
Ga0302221_1004245833300028806PalsaMARKALGLLLPASMAVLAVSQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSV
Ga0302228_1004505813300028808PalsaARKALSLLLPASVAVLVASQWRELSRYLKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPASA
Ga0302218_1017651513300028863PalsaLLPASVAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPASA
Ga0302235_1009547223300028877PalsaMARKALSLLLPASVAVLAATQWRELSRYIKLRQMSSGGGHPESVPVEGHHSYPKGPGGGVPDGTGDFDSASRGGGPVSA
Ga0302235_1018926513300028877PalsaMASKALLLLVPAAAAAAVASQWREISRYLKVAQMSSGGGNPQVVPVHGVQGYEHPGGGDSDGTGQFDSLSRGGGPIA
Ga0302229_1015912423300028879PalsaMASKALLLLVPAAAAAAVASQWREISRYLKVAQMSSGGGNPQVVPVHGVQGYKHPGGGESDGTGQFDSLSRGGGPIA
Ga0302229_1031570023300028879PalsaMARKALSLLLPASVAVLAATQWRELSRYIKLRQMSSGGGHPESVPVEGHHSYPKGPGGGVPDGTGDFDSASRGGG
Ga0308309_1001877833300028906SoilMARRALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVTA
Ga0311368_1086598313300029882PalsaMARKALSLLLPASVAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKGPGSGVPDGT
Ga0311368_1103778613300029882PalsaMARKALSLLLPVSAAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSASRGGGPVSA
Ga0311369_1014180323300029910PalsaMARKALSLLLPASVAVLVASQWRELSRYLKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSASRGGGPVSA
Ga0311369_1127864513300029910PalsaMASKALLLLVPAAAAAVVASQWRELSRYLKLAQMSASGGNPQVVPVHGVQGYEHPGGGDSDGTGQFDSLSRGGGPIA
Ga0311340_1004568023300029943PalsaMASKALLLLVPAAAAAVVASQWREISRYLKVAQMSSGGGNPQVVPVHGVQGYEHPGGGDSDGTGQFDSLSRGGGPIA
Ga0311340_1140007223300029943PalsaMARKALSLLLPASVAVLAASQWREISRYLKLRQMSSGGGHPENVPVEGHHSYPKAPGGGVPDGTGDFDSGSRGGGPVSA
Ga0311371_1072107623300029951PalsaMARKALSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASR
Ga0302178_1004121843300030013PalsaKALLLLVPAAAAAAVASQWREISRYLKVAQMSSGGGNPQVVPVHGVQGYKHPGGGESDGTGQFDSLSRGGGPIA
Ga0302306_1013073523300030043PalsaLGLLLPASMAVLAVSQWRELSRYIKLRQMSSGDGHPENVPVEGHHSYPSGPGSGVPDGTGDFDSGSRGGGPVSA
Ga0302177_1000301633300030053PalsaMARKALGLLLPASMAVLAVSQWRELSRYIKLRQMSSGDGHPENVPVEGHHSYPSGPGSGVPDGTGDFDSGSRGGGPVSA
Ga0302179_1003792123300030058PalsaMARKALSLLLPASVAVLAVSQWRELSRYIKLRQMSSGGGHPESVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPASA
Ga0311353_1026258123300030399PalsaMARKALSLLLPASVAVLAATQWRELSRYIKLRQMSSGGGHPESVPVEGHHSYPKGPGGGVPDGTGDFD
Ga0302184_1011230423300030490PalsaMARKALSLLLPASVAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKGPGGGVPDGTGDFDSPSRGGGPVSA
Ga0302317_1029852223300030677PalsaMARKALSLLLPASVAVLAVSQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSV
Ga0302311_1070803723300030739PalsaMARKALSLLLPASVAVLVASQWRELSRYLKLRQMSSGGGHPENVPVEGHHSYPKGPGSGVPDGTGDFDSPSRGGGPVSE
Ga0265460_1225146613300030740SoilIMARKALSLLLSASVAVLAASQWQEITRYIKLRQMSSGSGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSV
Ga0265461_1178985323300030743SoilMASKALLLLIPASVAVAVASQWREISRYIKLEQMSAGGGHPENVPIEGVHAYPSPGAGEPDGTGEFDSGSRGGPQTA
Ga0265461_1344021813300030743SoilKALFLLIPAVALAVASQWREINRYIKLEQMSSGGGHPENVPVEGVAAYPSPGSGASDGTGEFDSGSRGGPNLA
Ga0074020_1110510213300030840SoilASKALLLLVPAAAAAVVASQWREISRYLKVAQMSSGDGHPQNVPASGVPGYKHPGAGDSDGTGQFDSASRGGGPVA
Ga0265777_11783113300030877SoilMARKALSLLLSASVAVLAASQWQEISRYIKLKQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSA
Ga0265760_1026102513300031090SoilTMVRKALLLLLPASLAVAVASQWRELTRYVKLEQMSSGGGHPENVPVEGVQGYQHPGGGDLDGTGDFDSASRGGPAPSL
Ga0302324_10021200523300031236PalsaMARKALSLLLPVSAAVLAASQWRELSRYFKLRQMSSGGGHPENVPVEGHHSYPKAPGGGVPDGTGDFDSASRGGGPVSA
Ga0302326_1169406713300031525PalsaMARKALSLLLPVSAAVLAASQWRELSRYFKLRQMSSGGGHPESVPVEGHHSYPKGPGGGVPDGTGDFDSASRGGGPVSA
Ga0310686_10543678833300031708SoilMARKGLLLLVPVSVAAVVASQWREINRYLKVAQMSSGGGHPENVPVSGVAAYPPPGGGEPDGTGQFDSASRGGGPVS
Ga0310686_10685114253300031708SoilMARKELSLLLSASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSA
Ga0348332_1009915123300032515Plant LitterMARKALSLLLFPASVAVLAASQWQEISRYIKLRQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSA
Ga0348332_1071007913300032515Plant LitterPNSRENHMARKGLLLLVPVSVAAVVASQWREINRYLKVAQMSSGGGHPENVPVSGVAAYPPPGGGEPDGTGQFDSASRGGGPVS
Ga0315741_1186322313300032739Forest SoilRGKRIMARKALSLLLLPASVAVLAASQWQEISRYLKLRQMSSGGGHPENVPVEGHHSYPTGPGGGVPDGTGDFDSPSRGGGPVAA
Ga0315742_1205757713300032756Forest SoilGTRGKKIMARKALSLLLPASVAVLAATQWQEITRYLKLRQMSSGGGHPENVPVEGHHAYPKAPGGGVPDGTGDFDSGSRGGGPVSA
Ga0315742_1286299023300032756Forest SoilARKALSLLLSASVAVLAASQWQEISRYIKLKQMSSGGGHPENVPVEGHHSYPNGPGGGVPDGTGDFNSASRGGGPVSA
Ga0335079_1033985223300032783SoilMARKALLLVPVSVAVLAASQWREISRYIKIQQMSRGGGNPQLVPAAGQHVYPSRPGAGAPDGTGEFDSASRGGPAPSAPSAPSAA
Ga0335071_1041680923300032897SoilMARKALLLVSVSVAVLAASQWREISRYIKIQQMSRGGGNPQLVPAAGQHAYPKRHGGASDGTGEFDSASRGGPAPPDPSAV
Ga0335076_1034964513300032955SoilMARKALLLVPVSVAVLAASQWREISRYIKIQQMSRGGGNPQLVPAAGQHAYPNRPGAGEPDGTGEFDSASRGGPAPSAPSAPSA
Ga0335073_1008500733300033134SoilMARKALLIVPVSVAVLAASQWREISRYIKIQQMSRGGGNPQLVPAAGQHAYPDRPGGGEPDGTGEFDSASRGGPAPSTPSGPPAA
Ga0370515_0005299_1732_19713300034163Untreated Peat SoilMARKALSLLLPASMAVLAASQWRELSRYIKLRQMSSGGGHPENVPVEGHHSYPKGPGAGVPDGTGDFDSGSRGGGPVSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.