Metagenome / Metatranscriptome Family F097709

Basic Information
Family ID	F097709
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	40 residues
Representative Sequence	LLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR
Number of Associated Samples	94
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.08 %
% of genes from short scaffolds (< 2000 bps)	88.46 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Bacteria (71.154 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.731 % of family members)
Environment Ontology (ENVO)	Unclassified (31.731 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (41.346 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF01411	tRNA-synt_2c	34.62
PF00441	Acyl-CoA_dh_1	9.62
PF02771	Acyl-CoA_dh_N	4.81
PF02798	GST_N	4.81
PF07973	tRNA_SAD	3.85
PF02661	Fic	2.88
PF09594	GT87	2.88
PF00083	Sugar_tr	2.88
PF07690	MFS_1	1.92
PF02770	Acyl-CoA_dh_M	0.96
PF00950	ABC-3	0.96
PF00437	T2SSE	0.96
PF02776	TPP_enzyme_N	0.96
PF03328	HpcH_HpaI	0.96
PF00248	Aldo_ket_red	0.96
PF07969	Amidohydro_3	0.96
PF00005	ABC_tran	0.96
PF13594	Obsolete Pfam Family	0.96
PF01609	DDE_Tnp_1	0.96
PF06983	3-dmu-9_3-mt	0.96
PF05443	ROS_MUCR	0.96
PF00293	NUDIX	0.96
PF13561	adh_short_C2	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG0013	Alanyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	34.62
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	15.38
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.96
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.96
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.96
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.96
COG4957	Predicted transcriptional regulator	Transcription [K]	0.96
COG4606	ABC-type enterochelin transport system, permease component	Inorganic ion transport and metabolism [P]	0.96
COG3865	Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase	General function prediction only [R]	0.96
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.96
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.96
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.96
COG2764	Zn-dependent glyoxalase, PhnB family	Energy production and conversion [C]	0.96
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.96
COG1108	ABC-type Mn2+/Zn2+ transport system, permease component	Inorganic ion transport and metabolism [P]	0.96
COG0609	ABC-type Fe3+-siderophore transport system, permease component	Inorganic ion transport and metabolism [P]	0.96
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.08 %
Unclassified	root	N/A	26.92 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.08 %
Unclassified	root	N/A	26.92 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	71.15 %
Unclassified	root	N/A	26.92 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.92 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	63.46 %
Unclassified	root	N/A	26.92 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.92 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.96 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.96 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	51.92 %
Unclassified	root	N/A	26.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.88 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.92 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	23.08 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	11.54 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.92 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.92 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.96 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.92 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.92 %
Stappiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae	0.96 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.96 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	0.96 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.92 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.96 %
Labrenzia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia	0.96 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.92 %
unclassified Labrenzia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia	0.96 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	0.96 %
pseudomallei group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.92 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Arachnida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Acari	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Parasitiformes	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Ixodida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Ixodoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Ixodinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Ixodinae	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Ixodes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Ixodinae → Ixodes	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.92 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	11.54 %
Ixodes ricinus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Ixodinae → Ixodes → Ixodes ricinus	1.92 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.96 %
Labrenzia sp. 011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	0.96 %
Sphingomonas sp. KC8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	0.96 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.96 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004009\|Ga0055437_10115878	All Organisms → cellular organisms → Bacteria	804	Open in IMG/M
3300004080\|Ga0062385_11113484	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	536	Open in IMG/M
3300004463\|Ga0063356_105001845	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300005180\|Ga0066685_10515688	Not Available	827	Open in IMG/M
3300005338\|Ga0068868_101411003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	650	Open in IMG/M
3300005355\|Ga0070671_102098744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	503	Open in IMG/M
3300005540\|Ga0066697_10445415	Not Available	746	Open in IMG/M
3300005559\|Ga0066700_10301526	All Organisms → cellular organisms → Bacteria → Proteobacteria	1129	Open in IMG/M
3300005561\|Ga0066699_10152168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1579	Open in IMG/M
3300005575\|Ga0066702_10024192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3016	Open in IMG/M
3300005586\|Ga0066691_10199435	All Organisms → cellular organisms → Bacteria → Proteobacteria	1165	Open in IMG/M
3300005764\|Ga0066903_105848488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	645	Open in IMG/M
3300005764\|Ga0066903_107417141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8	566	Open in IMG/M
3300005872\|Ga0058710_1007704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	531	Open in IMG/M
3300006046\|Ga0066652_100118624	Not Available	2167	Open in IMG/M
3300006176\|Ga0070765_100804031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	889	Open in IMG/M
3300006794\|Ga0066658_10844518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	521	Open in IMG/M
3300006854\|Ga0075425_102854297	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300006871\|Ga0075434_101439138	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300007788\|Ga0099795_10048546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1537	Open in IMG/M
3300009089\|Ga0099828_11696885	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	555	Open in IMG/M
3300009137\|Ga0066709_104588301	All Organisms → cellular organisms → Bacteria → Proteobacteria	505	Open in IMG/M
3300010046\|Ga0126384_12337915	Not Available	516	Open in IMG/M
3300010046\|Ga0126384_12477567	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	503	Open in IMG/M
3300010048\|Ga0126373_10133102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2342	Open in IMG/M
3300010358\|Ga0126370_10747129	All Organisms → cellular organisms → Bacteria → Proteobacteria	866	Open in IMG/M
3300010366\|Ga0126379_11624077	Not Available	751	Open in IMG/M
3300010366\|Ga0126379_13193434	Not Available	549	Open in IMG/M
3300010376\|Ga0126381_102594031	Not Available	725	Open in IMG/M
3300010376\|Ga0126381_104443571	Not Available	542	Open in IMG/M
3300012189\|Ga0137388_11680130	Not Available	569	Open in IMG/M
3300012198\|Ga0137364_10049484	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2792	Open in IMG/M
3300012683\|Ga0137398_10478168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	855	Open in IMG/M
3300012923\|Ga0137359_10360928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1291	Open in IMG/M
3300012924\|Ga0137413_10045663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2509	Open in IMG/M
3300012944\|Ga0137410_10086987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2295	Open in IMG/M
3300012971\|Ga0126369_10853865	Not Available	994	Open in IMG/M
3300013306\|Ga0163162_13103516	All Organisms → cellular organisms → Bacteria → Proteobacteria	533	Open in IMG/M
3300014052\|Ga0120109_1046514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	979	Open in IMG/M
3300014150\|Ga0134081_10222460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	649	Open in IMG/M
3300014969\|Ga0157376_11028909	All Organisms → cellular organisms → Bacteria → Proteobacteria	847	Open in IMG/M
3300016270\|Ga0182036_10593132	Not Available	888	Open in IMG/M
3300016319\|Ga0182033_10135193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1879	Open in IMG/M
3300016357\|Ga0182032_11691221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	552	Open in IMG/M
3300016387\|Ga0182040_11338437	All Organisms → cellular organisms → Bacteria → Proteobacteria	605	Open in IMG/M
3300018064\|Ga0187773_11228451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	505	Open in IMG/M
3300018433\|Ga0066667_11034180	All Organisms → cellular organisms → Bacteria → Proteobacteria	709	Open in IMG/M
3300020006\|Ga0193735_1017683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2220	Open in IMG/M
3300020579\|Ga0210407_10717053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	775	Open in IMG/M
3300020582\|Ga0210395_11347004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	522	Open in IMG/M
3300021171\|Ga0210405_10548709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	903	Open in IMG/M
3300021377\|Ga0213874_10332912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	578	Open in IMG/M
3300021403\|Ga0210397_11437042	Not Available	536	Open in IMG/M
3300021407\|Ga0210383_11380122	Not Available	587	Open in IMG/M
3300021432\|Ga0210384_10405927	Not Available	1227	Open in IMG/M
3300021444\|Ga0213878_10083876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1280	Open in IMG/M
3300021560\|Ga0126371_10462126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1416	Open in IMG/M
3300021560\|Ga0126371_10838333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1065	Open in IMG/M
3300021861\|Ga0213853_10883135	Not Available	582	Open in IMG/M
3300025903\|Ga0207680_11084050	Not Available	573	Open in IMG/M
3300025915\|Ga0207693_10202204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	1562	Open in IMG/M
3300025915\|Ga0207693_10389574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1090	Open in IMG/M
3300025916\|Ga0207663_10371429	Not Available	1087	Open in IMG/M
3300025928\|Ga0207700_10734016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	882	Open in IMG/M
3300026552\|Ga0209577_10357835	Not Available	1071	Open in IMG/M
3300027182\|Ga0208952_1009761	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Ixodinae → Ixodes → Ixodes ricinus	531	Open in IMG/M
3300027846\|Ga0209180_10111115	All Organisms → cellular organisms → Bacteria	1567	Open in IMG/M
3300027882\|Ga0209590_10198533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1267	Open in IMG/M
3300028906\|Ga0308309_11780438	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Ixodinae → Ixodes → Ixodes ricinus	521	Open in IMG/M
3300031469\|Ga0170819_13110013	Not Available	515	Open in IMG/M
3300031546\|Ga0318538_10123479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1353	Open in IMG/M
3300031546\|Ga0318538_10380366	Not Available	763	Open in IMG/M
3300031640\|Ga0318555_10590353	All Organisms → cellular organisms → Bacteria → Proteobacteria	602	Open in IMG/M
3300031680\|Ga0318574_10739090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	577	Open in IMG/M
3300031708\|Ga0310686_118864228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1008	Open in IMG/M
3300031748\|Ga0318492_10295862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011	842	Open in IMG/M
3300031753\|Ga0307477_10947979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	566	Open in IMG/M
3300031765\|Ga0318554_10599907	Not Available	621	Open in IMG/M
3300031768\|Ga0318509_10639050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	592	Open in IMG/M
3300031769\|Ga0318526_10011455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2886	Open in IMG/M
3300031769\|Ga0318526_10178493	Not Available	866	Open in IMG/M
3300031781\|Ga0318547_10012370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3965	Open in IMG/M
3300031819\|Ga0318568_10715661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	622	Open in IMG/M
3300031819\|Ga0318568_10875711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	556	Open in IMG/M
3300031859\|Ga0318527_10331626	Not Available	648	Open in IMG/M
3300031890\|Ga0306925_10017076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	7164	Open in IMG/M
3300031897\|Ga0318520_10379749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	861	Open in IMG/M
3300031897\|Ga0318520_10489434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	759	Open in IMG/M
3300031910\|Ga0306923_10667977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1160	Open in IMG/M
3300031945\|Ga0310913_11303708	Not Available	504	Open in IMG/M
3300031959\|Ga0318530_10335959	Not Available	625	Open in IMG/M
3300031965\|Ga0326597_10093194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3679	Open in IMG/M
3300032009\|Ga0318563_10705122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	542	Open in IMG/M
3300032041\|Ga0318549_10515049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	538	Open in IMG/M
3300032042\|Ga0318545_10004442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3936	Open in IMG/M
3300032052\|Ga0318506_10102113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1226	Open in IMG/M
3300032054\|Ga0318570_10502236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	553	Open in IMG/M
3300032064\|Ga0318510_10222875	Not Available	768	Open in IMG/M
3300032066\|Ga0318514_10749463	Not Available	519	Open in IMG/M
3300032089\|Ga0318525_10105404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1438	Open in IMG/M
3300032091\|Ga0318577_10067599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1632	Open in IMG/M
3300032094\|Ga0318540_10136451	Not Available	1171	Open in IMG/M
3300032180\|Ga0307471_103421727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	562	Open in IMG/M
3300032896\|Ga0335075_10967369	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.35%
Host-Associated	Host-Associated	8.65%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	88.46%
Plants	Host-Associated → Plants	8.65%
Aquatic	Environmental → Aquatic	2.88%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	88.46%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.81%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.88%
Freshwater	Environmental → Aquatic → Freshwater	1.92%
Marine	Environmental → Aquatic → Marine	0.96%
Roots	Host-Associated → Plants → Roots	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	78.85%
Loam	Environmental → Terrestrial → Soil → Loam	7.69%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.88%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.92%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.92%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.96%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.96%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.96%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	42.31%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.58%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.88%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.96%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.96%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.96%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.96%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	31.73%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.58%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.92%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil	1.92%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.92%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.92%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.96%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.96%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.96%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.96%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.96%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.96%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.96%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.96%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004009	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2	Environmental	Open in IMG/M
3300004080	Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005872	Bulk soil microbial communities from Harvard Forest, USA - 3Bulk_unsorted metaG	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014052	Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021444	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027182	Bulk soil microbial communities from Harvard Forest, USA - 3Bulk_unsorted metaG (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031469	Fir Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031769	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental	Open in IMG/M
3300031859	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032041	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032052	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032064	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17	Environmental	Open in IMG/M
3300032066	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097709

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0055437_101158782	3300004009	Natural And Restored Wetlands	RSTLLWALTRLREGDDPAALVALGAKNGVDIAALPAVAARLR*
Ga0062385_111134842	3300004080	Bog Forest Soil	SGTRSALLWALTRMRDGADPLALIAEAARHGIDIAGLPAVAARLR*
Ga0063356_1050018452	3300004463	Arabidopsis Thaliana Rhizosphere	TRSTLLWALVRLREGADPSALIGEAARHGIDIAALPAIAARLR*
Ga0066685_105156882	3300005180	Soil	LLWALSRMRERADPLALIAEAARHGIDIAGLPAVAARLR*
Ga0068868_1014110033	3300005338	Miscanthus Rhizosphere	LLWALVRLREGAEPSSLVAEAARYGIDIAALPAIAARLR*
Ga0070671_1020987441	3300005355	Switchgrass Rhizosphere	SGTRSTLLWALVRLREGAEPLQLVAEAARYGIDIAALPVIAARL*
Ga0066697_104454151	3300005540	Soil	TRSALLWALSRMRERADPLALIAEAARHGIDIAGLPAVAARLR*
Ga0066700_103015261	3300005559	Soil	SALLWALARMREGADPNALVAEAACHGIDIAALPAIAARLR*
Ga0066699_101521682	3300005561	Soil	LLWALTRMREGENALSLIAEAAQHGIDIAGLPAVAARLR*
Ga0066702_100241921	3300005575	Soil	CRSGTRSALLWALTRMREGANSLSLIAEAAQHGIDIAGLPAVAARLR*
Ga0066691_101994352	3300005586	Soil	GTRSTLLWALARMREGADPFALVAEAARHGIDIAALPAIAARLR*
Ga0066903_1058484882	3300005764	Tropical Forest Soil	VRMREGADPLSLVAEAAHHGIDIANLPAVAARLR*
Ga0066903_1074171411	3300005764	Tropical Forest Soil	RSALLWALVRMREGADALSLIATAAQHGIDIANLPAVAARLR*
Ga0058710_10077042	3300005872	Bulk Soil	SALLWALARMREGADPGSLIAEAARHGIDIAALPAFAARLR*
Ga0066652_1001186241	3300006046	Soil	LSRMRERADPLALIAEAARHGIDIAALPAVAARLR*
Ga0070765_1008040311	3300006176	Soil	TRSALLWALARMREGADPGSLIAEAARHGIDIAALPAFAARLR*
Ga0066658_108445181	3300006794	Soil	GTRSALLWALARLRQGDDPAALVAEAARHGIDIAALPALAARLG*
Ga0075425_1028542971	3300006854	Populus Rhizosphere	SGTRSTLLWSLTRIDQGADPAALVAQAARNGIDIAALPMIAARLR*
Ga0075434_1014391381	3300006871	Populus Rhizosphere	SGTRSTLLWALVRMREGADPLSLIAEAAHHGIDIAGLPAVAARLR*
Ga0099795_100485462	3300007788	Vadose Zone Soil	STLLWALMRMREGANALSLIAEAAQHGVDIASLPAVAARLR*
Ga0099828_116968851	3300009089	Vadose Zone Soil	LLWALARMRDGADPLALVGEAARHGIDIAALPTIAARLR*
Ga0066709_1045883012	3300009137	Grasslands Soil	ALHWEWERIRASADPVALVAEAARHGIDIAALPAIAARLR*
Ga0126384_123379151	3300010046	Tropical Forest Soil	TRSALLWALTRLRDGADPLSLITTAAQHGIDIAGLPALAARLR*
Ga0126384_124775672	3300010046	Tropical Forest Soil	ALLWALSRMRERADPLALIAEAARHGIDIASLPAVAARLR*
Ga0126373_101331021	3300010048	Tropical Forest Soil	LLWALTRLREGADPLSLIATAAQHGIDIAGLPAVAARLR*
Ga0126370_107471293	3300010358	Tropical Forest Soil	LTQLDEGADPAALIERAARQGIDIAALPAFAARLR*
Ga0126379_116240771	3300010366	Tropical Forest Soil	GRMREGADPLALVAEAARHGIDIASLAAVAARLR*
Ga0126379_131934342	3300010366	Tropical Forest Soil	TRMRQGANAFSLIAEAAQHGIDIASLPAVAARLR*
Ga0126381_1025940311	3300010376	Tropical Forest Soil	SALLWALTRLREGADPLSLIAEAARHGIDIAGLPAVAARLR*
Ga0126381_1044435711	3300010376	Tropical Forest Soil	SGTRSALLWALTRLREGADPLSLIATAAQHGIDIAGLPAVAARLR*
Ga0137388_116801301	3300012189	Vadose Zone Soil	LVALPRMREGADPLSLIAEVAGHGIDIATLPAVAARLR*
Ga0137364_100494844	3300012198	Vadose Zone Soil	ALTRLDEGADANALIATAAAYGIDIAALPAIAARLG*
Ga0137398_104781682	3300012683	Vadose Zone Soil	LIWALTRLREGADPNALIAQAARHGIDIAALPAIAARLG*
Ga0137359_103609283	3300012923	Vadose Zone Soil	LWALSRMRDRADPLALIAEAARHGIDIAGLPAVAARLR*
Ga0137413_100456631	3300012924	Vadose Zone Soil	SGTRSTLLWALMRMREGANALSLIAEAAQHGVDIASLPAVAARLR*
Ga0137410_100869872	3300012944	Vadose Zone Soil	STLLWALTRMREGANALSLIAEAAQHGIDIASLPAVAARLR*
Ga0126369_108538651	3300012971	Tropical Forest Soil	VRMREGADPLSLIAEAARHGIDIANLPAVAARLR*
Ga0163162_131035161	3300013306	Switchgrass Rhizosphere	ALVQLREGADPTALIGEAARHGIDIASLPAIAARLR*
Ga0120109_10465141	3300014052	Permafrost	TRSTLLWALTRLGEGADPALLVAEAARHGIDIAALPVIAARLG*
Ga0134081_102224602	3300014150	Grasslands Soil	TRLDEGADANALIATAAAYGIDIAALPAIAARLG*
Ga0157376_110289092	3300014969	Miscanthus Rhizosphere	VVPEELSSRLDDGADANGLIATAARYGIDIAALPAIAARLG*
Ga0182036_105931321	3300016270	Soil	HCRSGTRSALLWALVRMREGADALSLIATAARHGIDIASLPAVAARLR
Ga0182033_101351931	3300016319	Soil	SGTRSTLLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR
Ga0182032_116912212	3300016357	Soil	RSTLLWALTRMREGADPLALVAEASRHGIDIASLPAVAARLR
Ga0182040_113384371	3300016387	Soil	HCRSGTRSALLWALVRMREGADPLSLVAEVARHGIDIANLPAVAARLR
Ga0187773_112284511	3300018064	Tropical Peatland	TLLWALTRLREGADPFALVAEAARHGIDIASLPAIAARLR
Ga0066667_110341801	3300018433	Grasslands Soil	LLWALTRLDEGADANALIATAAAYGIDIAALPAIAARLG
Ga0193735_10176833	3300020006	Soil	ALTRLDEGADANALIATAAAYGIDIAALPAIAARLG
Ga0210407_107170532	3300020579	Soil	TLLWALTRMREGANALSLIAEAAQHGIDIASLPAVAARLR
Ga0210395_113470042	3300020582	Soil	WALTRLREGADPLALIAEAARHGIDIAGLPSVAARLRQMP
Ga0210405_105487091	3300021171	Soil	TLLWALTRMREGGNALSLIAEAAQHGIDIAGLPAVAARLR
Ga0213874_103329121	3300021377	Plant Roots	LWALTRLRDGADPLTLIAEAARHGIDIAGLPAVAARLR
Ga0210397_114370421	3300021403	Soil	LLWALSRMRERADPLALIAEAARHGIDIASLPAVAARLR
Ga0210383_113801221	3300021407	Soil	CRSGTRSALLWALTRMREGANALSLIAEAAQHGIDIAGLPAVAARLR
Ga0210384_104059272	3300021432	Soil	RSGTRSALLWALTRVREGGNSLSLIAEAAQHGIDIASLPAVAARLR
Ga0213878_100838762	3300021444	Bulk Soil	CRSGTRSALLWALTRMREGANALSLIAEAAQYGIDIAGLPAVAARLR
Ga0126371_104621261	3300021560	Tropical Forest Soil	TRSALLWALTRLRGGADPLSLIAEAARHGIDIAGLPAVAARLR
Ga0126371_108383331	3300021560	Tropical Forest Soil	HCRSGTRSALLWALVRMREGADALSLIATAAQHGIDIASLPAVAARLR
Ga0213853_108831351	3300021861	Watersheds	LTRMAEGADPAALVAVAARHGIDIAALPVIAARLR
Ga0207680_110840502	3300025903	Switchgrass Rhizosphere	LLWALVRMREGADPFALIGEAARHGIDIAALPTIAARLR
Ga0207693_102022043	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	ALTRLREGADPNTLIAEAARHGIDIAALPAIAARLS
Ga0207693_103895742	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	GTRSALLWALTRMREGANALSLIAEAAQHGIDIAGLPAVAARLR
Ga0207663_103714292	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	SGTRSTLLWALTRLDDGADANGLIATAARYGIDIAALPAIAARLG
Ga0207700_107340161	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	RSALLCLTRMREGADPLSLIAAAAHHGIDIPGLPAIAARLR
Ga0209577_103578352	3300026552	Soil	SGTRSALLWALARMREGADPFALVAEAARHGIDIAALPAIAARLP
Ga0208952_10097611	3300027182	Bulk Soil	SALLWALARMREGADPGSLIAEAARHGIDIAALPAFAARLR
Ga0209180_101111151	3300027846	Vadose Zone Soil	WALARMRDGADPLALVAAAARHGIDIAALPAIAARLR
Ga0209590_101985333	3300027882	Vadose Zone Soil	LLWALARMRDGADPSALVAEAARHGIDIAALPAIAARLG
Ga0308309_117804382	3300028906	Soil	TRSTLLWALTRMREGADPFALVAEAARHGIDIAALPAIATRLR
Ga0170819_131100132	3300031469	Forest Soil	WALSRMRERADPLALIAEAARHGIDIAGLPAVAARLR
Ga0318538_101234791	3300031546	Soil	SGTRSMLLWALSRMREGADPFALVAEAGRHGIDIASLPAIAARLR
Ga0318538_103803661	3300031546	Soil	RSGTRSALLWALVRMREGADALSLIATAARHGIDIASLPAVAARLR
Ga0318555_105903532	3300031640	Soil	LWALTRLRDGADPLSLIAEAARHGIDIAGLPAVAARLR
Ga0318574_107390902	3300031680	Soil	GTRSALLWGLTRLREGADPLALIAAAARHGIDIAGLPAIAARLR
Ga0310686_1188642282	3300031708	Soil	WALTRMREGADPLALISEAARHGIDIAGLPAVAARLR
Ga0318492_102958621	3300031748	Soil	STLLWALTRMREGADPLGLIAEAARHGIDIASLPAVAARLR
Ga0307477_109479791	3300031753	Hardwood Forest Soil	LLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR
Ga0318554_105999072	3300031765	Soil	WALVRMREGADALSLIATAARHGIDIASLPAVAARLR
Ga0318509_106390501	3300031768	Soil	RTGTRSTLLWALVRMREGADALALVAEAARHGIDIASLPAVAARLR
Ga0318526_100114551	3300031769	Soil	LWALGRMREGADPLALVAEAARHGIDIASLPAVAARLR
Ga0318526_101784931	3300031769	Soil	WALTRLRDGVDPLSLIAEAARHGIDIAGLPAVAARLR
Ga0318547_100123703	3300031781	Soil	ALGRMREGADPLALVAEAARHGIDIASLPAVAARLR
Ga0318568_107156612	3300031819	Soil	LWALTRMREGADPLALVAEAARHGIDIASLPSVAARLR
Ga0318568_108757112	3300031819	Soil	LLWALSRMREGADPFALVAEAARHGIDIASLPAIAARLR
Ga0318527_103316261	3300031859	Soil	RSGTRSTLLWALTRMREGANSLSLIAEAAGHGIDIASLPAVAARLR
Ga0306925_100170767	3300031890	Soil	TRSTLLWALSRMREGADPFALVAEAGRHGIDIASLPAIAARLR
Ga0318520_103797491	3300031897	Soil	LWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR
Ga0318520_104894341	3300031897	Soil	LWALSRMREGADPFALVAEAARHGIDIASLPAIAARLR
Ga0306923_106679771	3300031910	Soil	TLLWALSRMREGADPFALVAEAGRHGIDIASLPAVGVRLR
Ga0310913_113037081	3300031945	Soil	TLLWALSQMREGADPFALVAEAARHGIDIASLPAIAARLR
Ga0318530_103359591	3300031959	Soil	LVRMREGADPFALVAEAARHGIDIAGLPAVAARLR
Ga0326597_100931941	3300031965	Soil	RSGTRSSLLWALVRLRDGDDPSALVAQAARHGINIAALPAIAARLG
Ga0318563_107051221	3300032009	Soil	LWALTRMREGANALSLIAEAAQHGIDIAGLPAVAARLR
Ga0318549_105150491	3300032041	Soil	LWALSRMREGADPFALVAEAGRHGIDIASLPAIAARLR
Ga0318545_100044423	3300032042	Soil	ALSRMREGADPLALVAEAARHGIDIASLPAVAARLR
Ga0318506_101021132	3300032052	Soil	ALLWALTRMHEGADPLALIAEVARHGIDIGDLPAIAARLR
Ga0318570_105022361	3300032054	Soil	ALLWALTRMREGADPLSLIAEAGKHGIDIAGLPAIAARLR
Ga0318510_102228751	3300032064	Soil	WALTRLRDGADPLSLIAEAARHGIDIAGLPAVAARLR
Ga0318514_107494631	3300032066	Soil	GTRSTLLWALSRMREGADPLALVAEAARQGIDIASLPAVAARLR
Ga0318525_101054042	3300032089	Soil	LWALGRMREGADPFALVAEAARHGIDIASLPAVAARLR
Ga0318577_100675991	3300032091	Soil	STLLWALVRMREGADALGLVAEAARHGIDIASLPAVAARLR
Ga0318540_101364512	3300032094	Soil	LWALTRMREGANSLSLIAEAAGHGIDIASLPAVAARLR
Ga0307471_1034217271	3300032180	Hardwood Forest Soil	TRSTLLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR
Ga0335075_109673691	3300032896	Soil	LVRLRDGDDPAGLIGQAARSGIDIAALPAIAARLGL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign