NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097667

Metagenome / Metatranscriptome Family F097667

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097667
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 81 residues
Representative Sequence LCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNP
Number of Associated Samples 81
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 18.45 %
% of genes near scaffold ends (potentially truncated) 92.31 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.462 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(79.808 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(69.231 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 80.95%    β-sheet: 0.00%    Coil/Unstructured: 19.05%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02600DsbB 73.08
PF03232COQ7 17.31
PF02230Abhydrolase_2 2.88
PF00108Thiolase_N 0.96
PF02653BPD_transp_2 0.96
PF01844HNH 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG1495Disulfide bond formation protein DsbBPosttranslational modification, protein turnover, chaperones [O] 73.08
COG2941Demethoxyubiquinone hydroxylase, CLK1/Coq7/Cat5 family (ubiquinone biosynthesis)Coenzyme transport and metabolism [H] 17.31
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.46 %
UnclassifiedrootN/A11.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2061766003|GB_4MN_MetaGALL_nosff_c19444Not Available1526Open in IMG/M
3300000115|DelMOSum2011_c10155030All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300000115|DelMOSum2011_c10218564Not Available521Open in IMG/M
3300000116|DelMOSpr2010_c10269278Not Available511Open in IMG/M
3300000140|LPfeb09P26500mDRAFT_c1003736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2438Open in IMG/M
3300000159|LPaug08P2610mDRAFT_c1010261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1163Open in IMG/M
3300000164|SI39no09_200mDRAFT_c1042844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales900Open in IMG/M
3300000181|LPjun08P4500mDRAFT_c1004337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2425Open in IMG/M
3300000248|LPfeb09P12500mDRAFT_1014403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1012Open in IMG/M
3300001349|JGI20160J14292_10136128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter795Open in IMG/M
3300001352|JGI20157J14317_10177069All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300001353|JGI20159J14440_10065740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1277Open in IMG/M
3300001353|JGI20159J14440_10163384All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300001516|TahiMoana_1072155Not Available545Open in IMG/M
3300001974|GOS2246_10015945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1271Open in IMG/M
3300003581|JGI26257J51711_1038377Not Available568Open in IMG/M
3300005239|Ga0073579_1191236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique42506Open in IMG/M
3300005431|Ga0066854_10116733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter892Open in IMG/M
3300005931|Ga0075119_1075288All Organisms → cellular organisms → Bacteria → Proteobacteria779Open in IMG/M
3300006190|Ga0075446_10031191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1725Open in IMG/M
3300006191|Ga0075447_10180728All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M
3300006310|Ga0068471_1065342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2964Open in IMG/M
3300006323|Ga0068497_1112405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2181Open in IMG/M
3300006352|Ga0075448_10133832All Organisms → cellular organisms → Bacteria → Proteobacteria770Open in IMG/M
3300006947|Ga0075444_10190000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter836Open in IMG/M
3300006947|Ga0075444_10215908All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300006947|Ga0075444_10238332All Organisms → cellular organisms → Bacteria → Proteobacteria720Open in IMG/M
3300006947|Ga0075444_10395347All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300007074|Ga0075110_1084112All Organisms → cellular organisms → Bacteria → Proteobacteria687Open in IMG/M
3300007229|Ga0075468_10195135All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300007862|Ga0105737_1177216All Organisms → cellular organisms → Bacteria → Proteobacteria560Open in IMG/M
3300008052|Ga0102893_1054374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1210Open in IMG/M
3300008950|Ga0102891_1137311All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300008961|Ga0102887_1186221All Organisms → cellular organisms → Bacteria → Proteobacteria636Open in IMG/M
3300009077|Ga0115552_1252074All Organisms → cellular organisms → Bacteria → Proteobacteria712Open in IMG/M
3300009124|Ga0118687_10238632All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300009173|Ga0114996_10553520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter860Open in IMG/M
3300009409|Ga0114993_10764676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales699Open in IMG/M
3300009409|Ga0114993_10998625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales596Open in IMG/M
3300009425|Ga0114997_10348347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter809Open in IMG/M
3300009425|Ga0114997_10674239All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300009441|Ga0115007_10207166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1265Open in IMG/M
3300009441|Ga0115007_10319437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1009Open in IMG/M
3300009467|Ga0115565_10274471All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300009476|Ga0115555_1295337All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300009497|Ga0115569_10369381All Organisms → cellular organisms → Bacteria → Proteobacteria622Open in IMG/M
3300009786|Ga0114999_10521282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter914Open in IMG/M
3300010368|Ga0129324_10396716Not Available533Open in IMG/M
3300011245|Ga0151673_102863Not Available530Open in IMG/M
3300012516|Ga0129325_1011666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales506Open in IMG/M
3300012522|Ga0129326_1029290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1176Open in IMG/M
3300012950|Ga0163108_10391604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique896Open in IMG/M
3300012950|Ga0163108_10633719Not Available691Open in IMG/M
3300012950|Ga0163108_10783517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales616Open in IMG/M
3300017770|Ga0187217_1243975All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300017786|Ga0181424_10471380Not Available505Open in IMG/M
3300018980|Ga0192961_10131692All Organisms → cellular organisms → Bacteria → Proteobacteria762Open in IMG/M
3300018980|Ga0192961_10165396All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300018980|Ga0192961_10256939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales511Open in IMG/M
3300019036|Ga0192945_10296739Not Available504Open in IMG/M
3300020324|Ga0211630_1073059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique695Open in IMG/M
3300020382|Ga0211686_10230837All Organisms → cellular organisms → Bacteria → Proteobacteria762Open in IMG/M
3300021065|Ga0206686_1198390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales576Open in IMG/M
3300022843|Ga0222631_1035191All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
(restricted) 3300024327|Ga0233434_1266682All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300025394|Ga0209825_1030734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter951Open in IMG/M
3300025465|Ga0209184_1086341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales574Open in IMG/M
3300025832|Ga0209307_1205901All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300025886|Ga0209632_10274451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter852Open in IMG/M
3300025886|Ga0209632_10466528All Organisms → cellular organisms → Bacteria → Proteobacteria584Open in IMG/M
3300025886|Ga0209632_10557966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales512Open in IMG/M
3300026262|Ga0207990_1130853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales612Open in IMG/M
3300027779|Ga0209709_10301975All Organisms → cellular organisms → Bacteria → Proteobacteria681Open in IMG/M
3300027780|Ga0209502_10112775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1361Open in IMG/M
3300027780|Ga0209502_10151444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1115Open in IMG/M
3300027780|Ga0209502_10458601All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300028131|Ga0228642_1169588Not Available511Open in IMG/M
3300028190|Ga0257108_1200052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales567Open in IMG/M
3300028414|Ga0228627_1119037All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
3300031143|Ga0308025_1217547All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300031143|Ga0308025_1224623All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300031519|Ga0307488_10814233All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300031588|Ga0302137_1269475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales565Open in IMG/M
3300031598|Ga0308019_10192038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique794Open in IMG/M
3300031598|Ga0308019_10306889All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300031599|Ga0308007_10153166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique823Open in IMG/M
3300031621|Ga0302114_10258667All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300031630|Ga0308004_10131257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1057Open in IMG/M
3300031630|Ga0308004_10336750All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300031637|Ga0302138_10220775All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300031644|Ga0308001_10359608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales533Open in IMG/M
3300031660|Ga0307994_1208372All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300031675|Ga0302122_10168611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique851Open in IMG/M
3300031676|Ga0302136_1202853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales584Open in IMG/M
3300031695|Ga0308016_10090052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1254Open in IMG/M
3300031695|Ga0308016_10104719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1145Open in IMG/M
3300031696|Ga0307995_1200518All Organisms → cellular organisms → Bacteria → Proteobacteria708Open in IMG/M
3300031700|Ga0302130_1042899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1490Open in IMG/M
3300031721|Ga0308013_10092745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1190Open in IMG/M
3300031721|Ga0308013_10213609All Organisms → cellular organisms → Bacteria → Proteobacteria706Open in IMG/M
3300031721|Ga0308013_10316307All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300031773|Ga0315332_10737188All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300032032|Ga0315327_10404109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique854Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.23%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.38%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine6.73%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine4.81%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater2.88%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.88%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.88%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.88%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.88%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.88%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.92%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.92%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm1.92%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.92%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.96%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.96%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.96%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.96%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.96%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.96%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents0.96%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume0.96%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.96%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2061766003Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 457EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000140Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P26 500mEnvironmentalOpen in IMG/M
3300000159Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10mEnvironmentalOpen in IMG/M
3300000164Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 200mEnvironmentalOpen in IMG/M
3300000181Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 500mEnvironmentalOpen in IMG/M
3300000248Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 500mEnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001353Pelagic Microbial community sample from North Sea - COGITO 998_met_09EnvironmentalOpen in IMG/M
3300001516Hydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokersEnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300003581Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_200m_DNAEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005431Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75EnvironmentalOpen in IMG/M
3300005931Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9EnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006310Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500mEnvironmentalOpen in IMG/M
3300006323Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0500mEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007074Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011245Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.2EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012950Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaGEnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300020324Marine microbial communities from Tara Oceans - TARA_B100000678 (ERX555936-ERR599033)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021065Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015EnvironmentalOpen in IMG/M
3300022843Saline water microbial communities from Ace Lake, Antarctica - #5EnvironmentalOpen in IMG/M
3300024327 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MGEnvironmentalOpen in IMG/M
3300025394Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8B Hudson Canyon (SPAdes)EnvironmentalOpen in IMG/M
3300025465Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8C Hudson Canyon (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026262Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028190Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000mEnvironmentalOpen in IMG/M
3300028414Seawater microbial communities from Monterey Bay, California, United States - 33DEnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031588Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCMEnvironmentalOpen in IMG/M
3300031598Marine microbial communities from water near the shore, Antarctic Ocean - #284EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031630Marine microbial communities from water near the shore, Antarctic Ocean - #38EnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031700Marine microbial communities from Western Arctic Ocean, Canada - CB9_surfaceEnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GB_4MN_031644502061766003Hydrothermal VentsLIIKYIVTAIATIISPKIENHFAASFSITLLKVSPNLNDKYETTKNRNPLDTRQTIKNIKILKPIIPLVIVNTLKGSGVKPA
DelMOSum2011_1015503013300000115MarineLCYLIIKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPARNKVASHT*
DelMOSum2011_1021856413300000115MarineLCYLIAKYIRVKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNPARNNV
DelMOSpr2010_1026927823300000116MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPARNKVASHT*
LPfeb09P26500mDRAFT_100373613300000140MarineLKIKYIVIAIVTIISPAIVNHFAASFSINLLKVSPNLNDKYETTKNRNPLDTKQTIKNIKILKPIIPLVMVNTLKGSGVKPARNRVPKK
LPaug08P2610mDRAFT_101026113300000159MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIM
SI39no09_200mDRAFT_104284423300000164MarineLCYLIAKYIRVKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNPARNKIQ*
LPjun08P4500mDRAFT_100433713300000181MarineLKIKYIVIAIVTIISPAIVNHFAASFSINLLKVSPNLNDKYETTKNRNPLDTKQTIKNIKILKPIIPLVMVNTLKGS
LPfeb09P12500mDRAFT_101440313300000248MarineLKIKYIVIAIVTIISPAIVNHFAASFSINLLKVSPNLNDKYETTKNRNPLDTKQTIKNIKILKPIIPLVMVNTLKGSGVKPAINRVPKKKIKFIPLDK
JGI20160J14292_1013612813300001349Pelagic MarineLCYLIKKYIRAKINTIIIPKIVNHFVASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVI
JGI20157J14317_1017706913300001352Pelagic MarineMFGYLIAKYIRVKINTIIIPKIVNHFAASAFINLVKISPNLYDRYETIKNLNPLENRQIMKN
JGI20159J14440_1006574013300001353Pelagic MarineLCYLIAKYIRVKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLK
JGI20159J14440_1016338413300001353Pelagic MarineLCYLIKKYIRAKINTIIIPKIVNHFVASVFINLLKISPNLYDRYETIKNLNPLENRQIMK
TahiMoana_107215513300001516Hydrothermal Vent PlumeLIIKYIVTAIATIISPKIENHFAASFSIILLKVSPNLNDKYETTKNRNPLDTRQTIKNIKILKPIIPLVIVNTLKGSGVKPARNRVPKKRIKLLPLDKLSFRFITFSS*
GOS2246_1001594533300001974MarineLIIKYIVTAIATIISPKIENHFAASFSIILLKVSPNLNDKYETTKNRNPLDTRQTIKNIKILKPIIPLVIVNTLKGSGVKPARNRVPKKRIKLLPLDK
JGI26257J51711_103837713300003581MarineYIRAKINTIIMPNIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNPARNKVASHI*
Ga0073579_1191236363300005239MarineLIIKYIVTAIATIIRPKIENHFAASFSIILLKVSPNLNDKYETTKNRNPLDTRQTIKNIKILKPIIPLVIVNTLKGSGVKPARNRVPKKE*
Ga0066854_1011673333300005431MarineLIIKYIVTAIATIISPKIENHFAASFSIILLKVSPNLNDKYETTKNRNPLDTRQTIKNIKILKPIIPLVIVNTLKGSGVKPARNKVPKKRIKLLPLDKL
Ga0075119_107528823300005931Saline LakeLCYLITKYIKAKINTIIIPKIVNHFAASVFINLLKKSPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVN
Ga0075446_1003119113300006190MarineLCYLIKKYIKAKINTITIPKIVNHFAASAFINLLKISPNLYDRYETRKNLSPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPAR
Ga0075447_1018072813300006191MarineMFCYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKG
Ga0068471_106534213300006310MarineLIIKYIVIAIATIISPAIENHFAASFSINLLKVSPNLNDKYETTKNRNPLDTKQTIKNIKILKPIIPLVMVNTLKGSGVKPARNRVPKKKIK
Ga0068497_111240513300006323MarineLIIKYIVIAIATIISPAIENHFAASFSINLLKVSPNLNDKYDTTKNRKPLDTKQTMKNIKILKPIIPLVIVNTLKGRGVKPARNKVPKKKIKLLPLDKL
Ga0075448_1013383213300006352MarineLCYLIKKYIKAKINTITIPKIVNHFAASAFINLLKISPNLYDRYETRKNLSPLENRQIMKNIGKLKPIMPLVIVNTLKGK
Ga0075444_1019000013300006947MarineMFCYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNI
Ga0075444_1021590813300006947MarineLCYLIKKYIKAKINTITIPKIVNHFAASAFINLLKISPNLYDRYETRKNLSPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNP
Ga0075444_1023833223300006947MarineLCYLIIKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIV
Ga0075444_1039534723300006947MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNI
Ga0075110_108411223300007074Saline LakeMFGYLITKYISAKINTIIIPKIVNHFAASFFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPI
Ga0075468_1019513523300007229AqueousLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLNGNGVNPARNKVA
Ga0105737_117721613300007862Estuary WaterLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNP
Ga0102893_105437433300008052EstuarineLCYLIAKYIRVKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLNGNGVNPARNKVASHT*
Ga0102891_113731123300008950EstuarineLCYLIAKYIRVKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNPAR
Ga0102887_118622123300008961EstuarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLK
Ga0115552_125207423300009077Pelagic MarineLYYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKLIIPLVIVNTL
Ga0118687_1023863223300009124SedimentLCYLIAKYIRVKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNPARNNVASHT*
Ga0114996_1055352033300009173MarineLIIKYIVTAIATIISPKIENHFVASFSITSLKASPNLNDKYETTKNLNPLDTRQTVKNIKILKPIIPLVIVNTLKGSGVKPARNKVPKKRIK
Ga0114993_1076467623300009409MarineLIIKYIVIAKATIISPTIENHFVAPFSINMLKVFPNLNDKYETTKNLNPLDTKQTIKNIKILKPIIPLVIVNTLNGRGVKPARNRVPKKKIKFLPFDKLIFKFT
Ga0114993_1099862523300009409MarineLIIKYIVTAIATIISPKIENHFVASFSITSLKASPNLNDKYETTKNLNPLDTRQTVKNIKILKPIIPLVIVNTLKGSGVKPARNKVPKKRIKL
Ga0114997_1034834713300009425MarineLTIKYITPKINIIAVPIIVNHMAAFVFINLLKVSPNLNEKYETIKNLKPLEIKQINKNMNKLKPIMPLVIVNTLNGNGVKPARNKV
Ga0114997_1067423913300009425MarineLPYLITKYISAKINTIIIPKIVNHFAASAFINLLKISPNLYDRYETIKNLNPLENRQIMKNI
Ga0115007_1020716613300009441MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPARN
Ga0115007_1031943713300009441MarineLCYLIIKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVI
Ga0115565_1027447113300009467Pelagic MarineLCYLITKYIRAKINTIIIPNIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLTPIIPLVIVNTLK
Ga0115555_129533723300009476Pelagic MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKRSPNLYDRYETIKNLKPLENRQIMKNIGKLKPIIPLVIVNTLKGKGV
Ga0115569_1036938113300009497Pelagic MarineLITKYIAAKINTIIIPTIVNHLAASVFINLLKISPNLYDKYETIKNLNPLENRQIIKNIGKLKPIIPLVIVNTLKGKGVNPARNK
Ga0114999_1052128233300009786MarineLIIKYIVTATETIISPKIENHFVASFSITLLKVSPNLNDKYETTKNLNPLDTRQTVKNIKILKPIIPLVIVNTLKGSGVKPARNK
Ga0129324_1039671613300010368Freshwater To Marine Saline GradientLCYLIVKYIRVKNNTIIIPKIVNHFAASVFINLLEISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGKGVNPARNNVA
Ga0151673_10286313300011245MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPA
Ga0129325_101166623300012516AqueousMFGYLIAKYIRVKINTIIIPKIVNHFAASVFINLVKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLKGK
Ga0129326_102929033300012522AqueousMFGYLIAKYIRVKINTIIIPKIVNHFAASVFINLVKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIV
Ga0163108_1039160413300012950SeawaterLIIKYIVIAIATIISPAIENHFAASFSINLLKVSPNLNDKYDTTKNRKPLDTKQTMKNIKILKPIIPLVIVNTLKGRGVKPARNRVPKK*
Ga0163108_1063371923300012950SeawaterLTIKYIVTAIATIISPKIKNHFVAFFSIILLKVSPNLNDKYETTKNRNPLDARQTIKNIKILKPIIPLVIVNTLKGSGV
Ga0163108_1078351713300012950SeawaterLIIKYIVAAIATIISPKIENHFATSFSIILLKVSPNLNDKYETTKNRNPLDIRQTIKNIKILKPIIPLVIVNTLKGSGVKPARNRVPKKRIKLLPLDKLSFRFIT
Ga0187217_124397513300017770SeawaterLYYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLKPLENRQIMKNIGKLKPIMPLVIVKTLKGKGVNPARNK
Ga0181424_1047138023300017786SeawaterLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRHIMKNIGKLKPIIPLVIVNTLNGSGVNPARNKLASHT
Ga0192961_1013169223300018980MarineLYYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVN
Ga0192961_1016539623300018980MarineLNYLITKYIRAKINTIIIPKIVNHFEASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVN
Ga0192961_1025693913300018980MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVN
Ga0192945_1029673913300019036MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPARNKVAS
Ga0211630_107305923300020324MarineLIIKYIVIAIATIISPAIENHFAASFSINLLKVSPNLNDKYDTTKNRKPLDTKQTMKNIKILKPIIPLVIVNTLKGRGVKPARNKVPKKKNKIITT
Ga0211686_1023083723300020382MarineLCYLITKYIRAKINTIIMPKIVNHLAASVSINLLKISPNLYDKYETIKNLNPLENRQIMKNIGKLKLIMPLVIVNTLKGKGVNPARNKVASH
Ga0206686_119839023300021065SeawaterLIIKYIVTAIATIIRPAIENHFAASFSINLLKALPNLNDKYETTKNRNPLETKQTIKNIKILKPIIPLVMVNTLKGSGVKPARNKVPK
Ga0222631_103519113300022843Saline WaterMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMP
(restricted) Ga0233434_126668213300024327SeawaterLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRHIMKNIGKLKP
Ga0209825_103073413300025394Methane Seep MesocosmLKIKYIVIAIATIISPAIANHFAASFSINLLKVSPNLNDKYETTKNRNPLDTKQTIKNIKILKPIIPLVMVNTLKGSGVKPARNRVPKKRIKLLPL
Ga0209184_108634113300025465Methane Seep MesocosmLKIKYIVIAIATIISPAIVNHFAASFSINLLKVSPNLNDKYETTKNRNPLDTKQTIKNIKILKPIIPLVMVNTLKGSGVKPARNRVPKKRIKFIPLDKL
Ga0209307_120590113300025832Pelagic MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKLIIPLVIV
Ga0209632_1027445133300025886Pelagic MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKLIIPLVIVNTLNGNGVN
Ga0209632_1046652813300025886Pelagic MarineLCYLITKYIRAKINTIVIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNI
Ga0209632_1055796613300025886Pelagic MarineLYYLITKYIRAKINTIVIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRHIMKNIGKLKPIIPLVIVNTLN
Ga0207990_113085323300026262MarineLKIKYIVIAIVTITSPAIVNHFAASFSINLLKVSPNLNDKYETTKNRNPLDTRQTIKNIKILKPIIPLVMVNTLKGSGVKPARNK
Ga0209709_1030197523300027779MarineLCYLITKYIKAKINTIIIPKIVNHFAASAFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTL
Ga0209502_1011277543300027780MarineLCYLIIKYIRAKINTIIIPIIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKG
Ga0209502_1015144433300027780MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKG
Ga0209502_1045860113300027780MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLV
Ga0228642_116958813300028131SeawaterLCYLIAKYIRVKINTIIIPKIVNHFVASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLNGNGVNPARNKV
Ga0257108_120005213300028190MarineLIIKYIVTAIATIISPAIENHFAASFSINLLKVSPNLNDKYDTTKNRKPLDTKQTMKNIKILKPIIPLVIVNTLKGRGVKPARNKVPKKKIKLLP
Ga0228627_111903713300028414SeawaterLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVKTLKGKGVNPARNKVASHT
Ga0308025_121754713300031143MarineLCYLITKYIKAKINTIIILKIVNHFAASAFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPARNKVASHT
Ga0308025_122462313300031143MarineLCYLITKYIKAKINTIIIPKIVNHFAASDFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKL
Ga0307488_1081423313300031519Sackhole BrineLCYLITKYIKAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVN
Ga0302137_126947513300031588MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPII
Ga0308019_1019203813300031598MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTL
Ga0308019_1030688913300031598MarineLCYLIIKYIRAKINTIIIPKIVNHFAASVFINPLKISPNLYDRYETIKNLDPLENRQIMKNIGKLKPIMPLVIVNTLKGKGV
Ga0308007_1015316633300031599MarineMFGYLIIKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQTMKNIGKLK
Ga0302114_1025866723300031621MarineLCYLITKYIKAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPARN
Ga0308004_1013125713300031630MarineVSYYLKIKYITQKITTIKIPKTVNHFAASVCINLLNVSPNLKDRYETMKNLKPLDIKQMKKNTNKLKPII
Ga0308004_1033675023300031630MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKG
Ga0302138_1022077513300031637MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNT
Ga0308001_1035960823300031644MarineVSYYLKIKYITQKITTIKIPKTVNHFAASVCINLLNVSPNLKDRYETIKNLKPLDIKQMKKNTNKLKPIIPLVIVNTLNGRG
Ga0307994_120837223300031660MarineLCYLITKYIKAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNPARNKVASH
Ga0302122_1016861133300031675MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNTGKLKP
Ga0302136_120285313300031676MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNTGKLKPIMPLV
Ga0308016_1009005233300031695MarineLCYLITKYIKAKINTIIIPKIVNHFAASDFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKFKPIMPLVIVNTLKGKG
Ga0308016_1010471913300031695MarineMFGYLIIKYISAKINTIIIPKIVNHFAASVFINLLKISPNLYDKYETIKNLNPLENRQIMKNIDKLK
Ga0307995_120051823300031696MarineLCYLITKYIKAKINTIIILKIVNHFAASAFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGKGVNP
Ga0307995_128573813300031696MarineMTTIKIPKIVNHFAASVCINLSNMSPNLNKRKEMIKNLKPLEIKHIKKNINKLKPIIPLVIVNTLNGRGVKPARNKVINQI
Ga0302130_104289913300031700MarineLCYLIIKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIIKNIG
Ga0308013_1009274513300031721MarineLCYLITKYIKAKINTIIIPKIVNHFAASVFINLLKISPNLYDKYETIKNLNPLENRQIIKNIGKL
Ga0308013_1021360923300031721MarineLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLSPLENRQIMKNIGKLK
Ga0308013_1031630713300031721MarineLCYLITKYIKAKINTIIIPKIVNHFAASAFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIMPLVIVNTLKGK
Ga0315332_1073718823300031773SeawaterLCYLITKYIRAKINTIIIPKIVNHFAASVFINLLKISPNLYDRYETIKNLNPLENRQIMKNIGKLKPIIPLVIVNTLNGKGVKPARNKVAS
Ga0315327_1040410933300032032SeawaterLKIKYIVIAIATIISPAIANHFVASFSINLLKVSPNLNDKYETTKNRNPLDTKQTIKNIKILKPIIPLVMVNTLKGSGVKPARNRVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.