NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097544

Metagenome Family F097544

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097544
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 45 residues
Representative Sequence MRRPPGPKPHFLIGNMPLASADPLAVFLGWAREFGDIFYYRAAWI
Number of Associated Samples 94
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 47.12 %
% of genes near scaffold ends (potentially truncated) 98.08 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.308 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.539 % of family members)
Environment Ontology (ENVO) Unclassified
(26.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.77%    β-sheet: 0.00%    Coil/Unstructured: 71.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF04715Anth_synt_I_N 39.42
PF07488Glyco_hydro_67M 9.62
PF01820Dala_Dala_lig_N 4.81
PF07478Dala_Dala_lig_C 4.81
PF03648Glyco_hydro_67N 4.81
PF01261AP_endonuc_2 2.88
PF07681DoxX 1.92
PF07813LTXXQ 0.96
PF00196GerE 0.96
PF01039Carboxyl_trans 0.96
PF00330Aconitase 0.96
PF01654Cyt_bd_oxida_I 0.96
PF13328HD_4 0.96
PF14078DUF4259 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0147Anthranilate/para-aminobenzoate synthases component IAmino acid transport and metabolism [E] 78.85
COG3661Alpha-glucuronidaseCarbohydrate transport and metabolism [G] 14.42
COG1181D-alanine-D-alanine ligase or related ATP-grasp enzymeCell wall/membrane/envelope biogenesis [M] 4.81
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 3.85
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 1.92
COG4270Uncharacterized membrane proteinFunction unknown [S] 1.92
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.96
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.96
COG1271Cytochrome bd-type quinol oxidase, subunit 1Energy production and conversion [C] 0.96
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.31 %
UnclassifiedrootN/A7.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001686|C688J18823_10351737All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300004092|Ga0062389_100922371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1057Open in IMG/M
3300004635|Ga0062388_100498856All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300005171|Ga0066677_10102322All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300005367|Ga0070667_102028453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300005434|Ga0070709_11314857All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005456|Ga0070678_101751760All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005468|Ga0070707_101986793All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005536|Ga0070697_101988927All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005537|Ga0070730_10458960All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300005546|Ga0070696_100127870All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300005547|Ga0070693_101209658All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005561|Ga0066699_10199705All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300005561|Ga0066699_10242158All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300006028|Ga0070717_10294829All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300006028|Ga0070717_11514747Not Available608Open in IMG/M
3300006034|Ga0066656_10175836All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300006059|Ga0075017_100030074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.3576Open in IMG/M
3300006237|Ga0097621_101343793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300006791|Ga0066653_10283461All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300006791|Ga0066653_10420681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300006806|Ga0079220_10274897All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300006904|Ga0075424_102032175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300009088|Ga0099830_10739090All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300009143|Ga0099792_10338084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300009148|Ga0105243_10806431All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300009176|Ga0105242_10310442All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300009545|Ga0105237_11926278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300010337|Ga0134062_10013471All Organisms → cellular organisms → Bacteria3039Open in IMG/M
3300010337|Ga0134062_10143175All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300010339|Ga0074046_10675525All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300010358|Ga0126370_11747068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300010358|Ga0126370_11855754All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300010359|Ga0126376_10281216All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300010360|Ga0126372_11133838All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300010373|Ga0134128_13219891All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300010376|Ga0126381_100092221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.3844Open in IMG/M
3300010396|Ga0134126_11870714All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300010397|Ga0134124_12661467All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300010398|Ga0126383_11735302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300010401|Ga0134121_10248607All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300010401|Ga0134121_11372276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300012199|Ga0137383_10846250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300012202|Ga0137363_10408517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1132Open in IMG/M
3300012207|Ga0137381_11556273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300012351|Ga0137386_10994885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300012532|Ga0137373_11210348All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012927|Ga0137416_11427834All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300012957|Ga0164303_10391296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300012976|Ga0134076_10222141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300013306|Ga0163162_12623163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300013307|Ga0157372_11776966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300013307|Ga0157372_11777168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300014497|Ga0182008_10459238Not Available694Open in IMG/M
3300015053|Ga0137405_1059698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1460Open in IMG/M
3300015241|Ga0137418_11075450Not Available575Open in IMG/M
3300015356|Ga0134073_10154832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300015357|Ga0134072_10015071All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300016319|Ga0182033_12217710All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300016387|Ga0182040_10497248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis974Open in IMG/M
3300017973|Ga0187780_11437068All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300018431|Ga0066655_10279859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300018431|Ga0066655_10312418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1025Open in IMG/M
3300018468|Ga0066662_10256178All Organisms → cellular organisms → Bacteria → Acidobacteria1434Open in IMG/M
3300019787|Ga0182031_1409150All Organisms → cellular organisms → Bacteria → Acidobacteria4025Open in IMG/M
3300019887|Ga0193729_1094460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1147Open in IMG/M
3300020579|Ga0210407_10160032All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300021171|Ga0210405_10661434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300021559|Ga0210409_10391518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1244Open in IMG/M
3300021560|Ga0126371_11384325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis835Open in IMG/M
3300025917|Ga0207660_11185980All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025924|Ga0207694_10156618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1838Open in IMG/M
3300025927|Ga0207687_10117661All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300025928|Ga0207700_10303624All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300025928|Ga0207700_11578193All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300025941|Ga0207711_11520946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300026325|Ga0209152_10112326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1033Open in IMG/M
3300026343|Ga0209159_1204898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300026532|Ga0209160_1041641All Organisms → cellular organisms → Bacteria2760Open in IMG/M
3300026538|Ga0209056_10502099All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300027061|Ga0209729_1011663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1003Open in IMG/M
3300027775|Ga0209177_10284978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300027846|Ga0209180_10795858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300027875|Ga0209283_10368506All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300027894|Ga0209068_10072397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1782Open in IMG/M
3300028381|Ga0268264_11550909All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300029907|Ga0311329_10011678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8131Open in IMG/M
3300029951|Ga0311371_10156599All Organisms → cellular organisms → Bacteria3478Open in IMG/M
3300031681|Ga0318572_10720284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis594Open in IMG/M
3300031736|Ga0318501_10705738All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031890|Ga0306925_11143448All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300031910|Ga0306923_10811022Not Available1033Open in IMG/M
3300031941|Ga0310912_10650321Not Available819Open in IMG/M
3300031945|Ga0310913_10415999Not Available954Open in IMG/M
3300031946|Ga0310910_10206408Not Available1525Open in IMG/M
3300031946|Ga0310910_10234090Not Available1433Open in IMG/M
3300031954|Ga0306926_12638402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis547Open in IMG/M
3300031981|Ga0318531_10076548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1453Open in IMG/M
3300032076|Ga0306924_10224335All Organisms → cellular organisms → Bacteria2158Open in IMG/M
3300032205|Ga0307472_102284155All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300032897|Ga0335071_10627738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1026Open in IMG/M
3300033289|Ga0310914_10184046All Organisms → cellular organisms → Bacteria1860Open in IMG/M
3300034090|Ga0326723_0571170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300034820|Ga0373959_0154206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.96%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J18823_1035173713300001686SoilMPRRPPGPKPHFLIGNMPLASPDPLPIFSAWAAEFGDIFYYRAAWLHVYFLN
Ga0062389_10092237113300004092Bog Forest SoilMLQRPPGPNPHFLIGNIPLAARNPLAVFSRWAKDYGDIFYYRAGWIHVYFLN
Ga0062388_10049885633300004635Bog Forest SoilMLQRPPGPNPHFLIGNIPLAARNPLAVFSRWAKDYGDIFYYRAGWIHVY
Ga0066677_1010232213300005171SoilMPTINYEFLMLRPPGPKPHFLIGNMPLASRNPLAVFSKWSAEFGDIF
Ga0070667_10202845313300005367Switchgrass RhizosphereMPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAG
Ga0070709_1131485723300005434Corn, Switchgrass And Miscanthus RhizosphereMPNRPPGPKPKFLIGNMPLASPDPLSIFSAWAREFGDIFYYRAAWLHVYFLN
Ga0070678_10175176013300005456Miscanthus RhizosphereMPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAGWIHVYFLNHPSL
Ga0070707_10198679313300005468Corn, Switchgrass And Miscanthus RhizosphereMPTVSIRPPGPPPKFLIGNFPLFSPDPLAVFTRWAREFGDIF
Ga0070697_10198892713300005536Corn, Switchgrass And Miscanthus RhizosphereMLRPPGPKPQFIIGNMPLASGDPLSVFEKWAHEFGDIFYYRAL
Ga0070730_1045896023300005537Surface SoilMLSRPPGPKPHFLIGNMPLASPDPLPIFSSWAAEFGDIFYYRAAWL
Ga0070696_10012787023300005546Corn, Switchgrass And Miscanthus RhizosphereMRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDIFYYR
Ga0070693_10120965823300005547Corn, Switchgrass And Miscanthus RhizosphereMPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDIFYY
Ga0066699_1019970513300005561SoilMTAVSNRRPPGPSPRFLIGNFPLFRRDPLAVFTRWAREFGD
Ga0066699_1024215813300005561SoilMPIRPPGPKPRFLIGNMPLASPDPLSIFSAWAREFGDIFYYRAAWLHVYF
Ga0070717_1029482923300006028Corn, Switchgrass And Miscanthus RhizosphereMKRPPGPKPHFPIGNMPLASNDPLGTYLGWAREYGDIFYYR
Ga0070717_1151474713300006028Corn, Switchgrass And Miscanthus RhizosphereMRMPKLLRPPGPKPQFVIGNVPLAARNPLATLQSWANEYGDI
Ga0066656_1017583623300006034SoilMPRRPPGPKPHFLIGNMPLASPDPLPIFSAWAAEFGDIFYYRA
Ga0075017_10003007413300006059WatershedsMSVALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYY
Ga0097621_10134379313300006237Miscanthus RhizosphereMPVAIQSRPPGPKPHFPIGNFPLAHANPLATFEKWAREFGDIF
Ga0066653_1028346123300006791SoilMANRRITRPPGPEQHFLIGNFPLGRPDPLAVFTGWAREFGDI
Ga0066653_1042068123300006791SoilMPNRSITRPPGPRPLFLIGNFPLGSPDPLAVFTGWAREFGD
Ga0079220_1027489723300006806Agricultural SoilMIRRPPGPKPRFLIGNLPLAGPDPLSVFLKWVQEFGDIFYYRAVWLRVYFL
Ga0075424_10203217513300006904Populus RhizosphereMPQNPLPPGPKPRFLIGNMPLASADPLARFENWARE
Ga0099830_1073909013300009088Vadose Zone SoilMNRPPGPRPHFIIGNMPLASREPLSVFTKWAAEFGDI
Ga0099792_1033808413300009143Vadose Zone SoilMPTVSIRPPGPPPKFLIGNFPLFSPDPLAVFTRWAREFGDIFYYRAGWIDV
Ga0105243_1080643123300009148Miscanthus RhizosphereMPKTLTHRPPGPKPHFPIGNFPLAHANPLATFEQWTHEFGDIFYYRAGWLPVYFLN
Ga0105242_1031044223300009176Miscanthus RhizosphereMKRPPGPKPHFPYGNMPLAGDDPLGTFLGWAREFG
Ga0105237_1192627823300009545Corn RhizosphereMPVAIQSRPPGPKPHFPIGNFPLAHANPLATFEKW
Ga0134062_1001347143300010337Grasslands SoilMANRRITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAG
Ga0134062_1014317523300010337Grasslands SoilMLRPPGPKPHFLIGNMPLASRNPLAVFSKWSAEFGDIFYYRAAWIQV
Ga0074046_1067552523300010339Bog Forest SoilMLQRPPVPKPHFLIGNIPLAARDPLAVFSRWAKDYG
Ga0126370_1174706823300010358Tropical Forest SoilMLRPPGPKPHFIIGNMPLAGHDPLTIFEKWAREYGDIFYYRALWIHVYFL
Ga0126370_1185575423300010358Tropical Forest SoilMRRPPGPQPHFLIGNMPLAHRDPLGTFEKWAREFGDIFYYR
Ga0126376_1028121623300010359Tropical Forest SoilMLRPPGPPPHFLIGNLPLAGKDPLATFLAWAREFGDIFYY
Ga0126372_1113383823300010360Tropical Forest SoilMLRPPGPKPRFLVGNLPLAGRDPLATFLSWAREFGDIFYYRAGWLHVYF
Ga0134128_1321989113300010373Terrestrial SoilMIRRPPGPKPRFLIGNLPLAGGDPLSVFLKWAQEFGDIFYYRA
Ga0126381_10009222113300010376Tropical Forest SoilMLRPPGPKPRFLVGNLPLAGRDPLATFLSWAREFGDIFYYRAGWLHVYFLNHP
Ga0134126_1187071423300010396Terrestrial SoilMKRPPGPKPHFLIGNMPLANRDPLATFLKWAREFGDIFYYR
Ga0134124_1266146713300010397Terrestrial SoilMPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDI
Ga0126383_1173530213300010398Tropical Forest SoilMPQNPLPPGPKPRFLIGNMPLASADPLARFENWAREYG
Ga0134121_1024860733300010401Terrestrial SoilMIRRPPGPKPRFLIGNLPLAGGDPLSVFLKWAQEFGDIFYYRAVWLRVYFLNHP
Ga0134121_1137227623300010401Terrestrial SoilMPVAIQSRPPGPKPHFPIGNFPLAHANPLATFEKWAREFGDIFYYRAG
Ga0137383_1084625013300012199Vadose Zone SoilMLRPPGPKPHFIIGNMPLAAHDPLATFEQWAREFGDIFYYRALW
Ga0137363_1040851713300012202Vadose Zone SoilMPNRSITRPPGPEPHFLVGNFPLGRPDPLAVFSGWAREFGDIFYYRAG
Ga0137381_1155627323300012207Vadose Zone SoilMANRRITRPPGPRPHFLIGNFPLGRPDPLAVFTGWAREFGDIF
Ga0137386_1099488533300012351Vadose Zone SoilMPAPTRDYPPGPKPHFLIGNFPLANRDPLRVFTGWAREFG
Ga0137373_1121034813300012532Vadose Zone SoilMANRRITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAGWIHVYFLNSPE
Ga0137416_1142783423300012927Vadose Zone SoilMRRPPGPKPHFLIGNMPLASADPLAVFLGWAREFGDIFYYRAAWI
Ga0164303_1039129613300012957SoilMPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAGWIHVYFLNHPS
Ga0134076_1022214123300012976Grasslands SoilVIFVVYQMPNRSITRPPGPEPHFLIGNFPLGSPDPLAVFSGWAREFGDIFYYRAGWIH
Ga0163162_1262316323300013306Switchgrass RhizosphereMPAVSRRPPGPPPRFLIGNLPLFNADPLAIYTRWAREFGD
Ga0157372_1177696613300013307Corn RhizosphereMPKTLTHRPPGPKPHFPIGNFPLAHANPLATFEQWTHEFGDIFYYRAGWLP
Ga0157372_1177716813300013307Corn RhizosphereMPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAR
Ga0182008_1045923813300014497RhizosphereMKRPPGPKPHFLIGNMPLASSDPLTEFQTWAREFGDI
Ga0137405_105969813300015053Vadose Zone SoilMPAVSRRPPGPPPRFLIGNLPLLFSPDPLAIYTRWAREFGDI
Ga0137418_1107545013300015241Vadose Zone SoilMKRPPGPKPHFLIGNMPLASSYPLAVFSKWGREFGDIFYYRAAWL
Ga0134073_1015483213300015356Grasslands SoilMANRRITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAGWIHVY
Ga0134072_1001507123300015357Grasslands SoilMPNRSITRPPGPKPRFLVGNFPLGRPDPLAVFSGWAREFGDIFY
Ga0182033_1221771013300016319SoilMQLRPPGPKPHFLIGNIPLANSNPLAVFQRWAAEYGDIFYYR
Ga0182040_1049724823300016387SoilMLRPSGPKPHFLVGNIPLAGPAPLDTFTRWAAQYGDIFYYRAAWLHVYFLN
Ga0187780_1143706813300017973Tropical PeatlandMLRPPGPKPQFLIGNIPLAGRDPLATYARWAAQYGDIF
Ga0066655_1027985923300018431Grasslands SoilMPNRSITRPPGPEPHFLIGNFPLGRPYPLAVFTGWAREFDDIFYYRAGWIHV
Ga0066655_1031241813300018431Grasslands SoilMPNRSITRPPGPEPHFLIGNFPLGRPDPLAVFSGWAREFGDFFYYRAGWIHVYFLNSPEL
Ga0066662_1025617823300018468Grasslands SoilMRRPPGPRPKFLIGNMPLASRDPLAVLAGWAREFG
Ga0182031_140915063300019787BogMLQRPPGPKPRFLIGNIPLASRDPLAVFRRWAQDYGDIFYYRAGWIHVYF
Ga0193729_109446013300019887SoilMPATSHRRPPGPPPRFLVGNFPLFSDDPLAVFSRWAREFGDIFYYRAGWINVYFL
Ga0210407_1016003233300020579SoilMPAIRRPPGPRPRFIVGQFPLLGDDPLAVFTRWARDFGDIFYYRAGWIHVYFLN
Ga0210405_1066143413300021171SoilMPALSRRPPGPPPRLLIGNLPLFSSDPLAIYTRWAREFGDIFYYRAGWIDVYFLNHPN
Ga0210409_1039151813300021559SoilMLPRPPGPRPHFLIGNMPLASRDPLAVFTRWAGEFGDVFY
Ga0126371_1138432513300021560Tropical Forest SoilMLRPPGPKPRFLIGNIPLVGPNPLDTFTSWAAEYGDIFYYRAAWL
Ga0207660_1118598023300025917Corn RhizosphereMLRPPGPKPHFLIGNMPLASRNPLAQFSQWANEFGDIFYYRAAWIHVYF
Ga0207694_1015661813300025924Corn RhizosphereMRRPPGPKPHFLIGNMPLASSDSLQTFLRWSQMFGDVFYYRAIWLHVYFLNDPD
Ga0207687_1011766123300025927Miscanthus RhizosphereMPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFY
Ga0207700_1030362413300025928Corn, Switchgrass And Miscanthus RhizosphereMIRRPPGPKPRFLIGNLPLAGGDPLSVFLKWAQEFGDIF
Ga0207700_1157819313300025928Corn, Switchgrass And Miscanthus RhizosphereMFSRPPGPKPHFLIGNMPLASPDPLPIFSAWAAEFGDIFYYRAAWLH
Ga0207711_1152094623300025941Switchgrass RhizosphereMPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAGWIHV
Ga0209152_1011232623300026325SoilMANRRITRPPGPKPRFLVGNFPLGRPDPLAVFSGWAREFGNIIY
Ga0209159_120489823300026343SoilMPNRSITRPPGPKPRFLVGNFPLGRPDPLAVFSGWAREFGDIFYYRAGWI
Ga0209160_104164113300026532SoilMPNRSITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAGWIH
Ga0209056_1050209913300026538SoilMTRNISRRPPGPKPHFIFGNMPLASHDPLAVFSAWAREFGDIFYYRAIWINVFFLNHPDL
Ga0209729_101166323300027061Forest SoilMRPRPPGPRPHFLIGNMPLASRNPLAVFTRWAREFG
Ga0209177_1028497823300027775Agricultural SoilMPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREF
Ga0209180_1079585823300027846Vadose Zone SoilMPAVSCRPPGPPPRFLIGNLPLFSSDPLAIYTRWAREFGDI
Ga0209283_1036850623300027875Vadose Zone SoilMSLRPPGPKPHFLIGNMPLASRNPLAVFSRWAGEYGDL
Ga0209068_1007239713300027894WatershedsMPAFPHRRPPGPPPRFLIGNFPLFSPDPLAVFTRWAREFGDIFYY
Ga0268264_1155090923300028381Switchgrass RhizosphereMKRPPGPKPHFLYGNMPLAGNDPLGTFLLWAREYGDIFY
Ga0311329_1001167813300029907BogMLQRPPGPKPRFLIGNIPLASRDPLAVFRRWAQDYGDIFYYRAGWIH
Ga0311371_1015659933300029951PalsaMLQRPPGPRPRFLIGNLPLASRNPLAVFSRWAKDYGDIFYYRAGWIHVYFLILT
Ga0318572_1072028413300031681SoilMLRPPGPKPHVLIGNIPLAGQAPLDTFRRWASEYGDVFYY
Ga0318501_1070573823300031736SoilMLRPSGPKPHFLVGNIPLAGPAPLDTFTRWAAQYGDIFYY
Ga0306925_1114344813300031890SoilMLCPPSPKPHFLIGNVSLAGPAPLETFTRWASEYGDIFYYRAAW
Ga0306923_1081102213300031910SoilMLSSAAPKRPPGPKPHFLIGNMPLASPDPLSLFTTWAREFGDMFY
Ga0310912_1065032123300031941SoilMLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIFY
Ga0310913_1041599923300031945SoilMLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDF
Ga0310910_1020640813300031946SoilMLHPPGPKPHFLIGNVPLAGRSPLDTFRRWTAEYGDI
Ga0310910_1023409023300031946SoilMLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIF
Ga0306926_1263840223300031954SoilMLRPPGPKPHVLIGNIPLAGQAPLDTFRRWASEYGDVFYYRAAWLHVY
Ga0318531_1007654813300031981SoilMLRPPGPKPHFLIGNIPLAGPDPLGTFTRWAAEYGDI
Ga0306924_1022433543300032076SoilMLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIFYYRALWLQVY
Ga0307472_10228415513300032205Hardwood Forest SoilMIRRPPGPKPRFLIGNLPLAGPDPLSVFLKWAQEFGDIFYYRAAWLRVYFLNHPDL
Ga0335071_1062773813300032897SoilMLFPPGPKPRFLIGNVPLFGRDPLGTFARWAAEYGDIFY
Ga0310914_1018404633300033289SoilMLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIFYYRALWLQVYFLNDP
Ga0326723_0571170_3_1523300034090Peat SoilMPAVLRRPPGPAPRFLIGNLPLFNSDPLAIYTRWAREFGDIFYYRAAWMD
Ga0373959_0154206_1_1173300034820Rhizosphere SoilMRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDIFY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.