Basic Information | |
---|---|
Family ID | F097544 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 45 residues |
Representative Sequence | MRRPPGPKPHFLIGNMPLASADPLAVFLGWAREFGDIFYYRAAWI |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 47.12 % |
% of genes near scaffold ends (potentially truncated) | 98.08 % |
% of genes from short scaffolds (< 2000 bps) | 92.31 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.308 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.539 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.77% β-sheet: 0.00% Coil/Unstructured: 71.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF04715 | Anth_synt_I_N | 39.42 |
PF07488 | Glyco_hydro_67M | 9.62 |
PF01820 | Dala_Dala_lig_N | 4.81 |
PF07478 | Dala_Dala_lig_C | 4.81 |
PF03648 | Glyco_hydro_67N | 4.81 |
PF01261 | AP_endonuc_2 | 2.88 |
PF07681 | DoxX | 1.92 |
PF07813 | LTXXQ | 0.96 |
PF00196 | GerE | 0.96 |
PF01039 | Carboxyl_trans | 0.96 |
PF00330 | Aconitase | 0.96 |
PF01654 | Cyt_bd_oxida_I | 0.96 |
PF13328 | HD_4 | 0.96 |
PF14078 | DUF4259 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 78.85 |
COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 14.42 |
COG1181 | D-alanine-D-alanine ligase or related ATP-grasp enzyme | Cell wall/membrane/envelope biogenesis [M] | 4.81 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.85 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.92 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.92 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.96 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.96 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.96 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.31 % |
Unclassified | root | N/A | 7.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001686|C688J18823_10351737 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300004092|Ga0062389_100922371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1057 | Open in IMG/M |
3300004635|Ga0062388_100498856 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300005171|Ga0066677_10102322 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300005367|Ga0070667_102028453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300005434|Ga0070709_11314857 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005456|Ga0070678_101751760 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300005468|Ga0070707_101986793 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005536|Ga0070697_101988927 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005537|Ga0070730_10458960 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300005546|Ga0070696_100127870 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
3300005547|Ga0070693_101209658 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005561|Ga0066699_10199705 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300005561|Ga0066699_10242158 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300006028|Ga0070717_10294829 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300006028|Ga0070717_11514747 | Not Available | 608 | Open in IMG/M |
3300006034|Ga0066656_10175836 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300006059|Ga0075017_100030074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 3576 | Open in IMG/M |
3300006237|Ga0097621_101343793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300006791|Ga0066653_10283461 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300006791|Ga0066653_10420681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300006806|Ga0079220_10274897 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300006904|Ga0075424_102032175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300009088|Ga0099830_10739090 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300009143|Ga0099792_10338084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
3300009148|Ga0105243_10806431 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300009176|Ga0105242_10310442 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300009545|Ga0105237_11926278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300010337|Ga0134062_10013471 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
3300010337|Ga0134062_10143175 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300010339|Ga0074046_10675525 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300010358|Ga0126370_11747068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300010358|Ga0126370_11855754 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300010359|Ga0126376_10281216 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
3300010360|Ga0126372_11133838 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300010373|Ga0134128_13219891 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300010376|Ga0126381_100092221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 3844 | Open in IMG/M |
3300010396|Ga0134126_11870714 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300010397|Ga0134124_12661467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300010398|Ga0126383_11735302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300010401|Ga0134121_10248607 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300010401|Ga0134121_11372276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300012199|Ga0137383_10846250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300012202|Ga0137363_10408517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
3300012207|Ga0137381_11556273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300012351|Ga0137386_10994885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300012532|Ga0137373_11210348 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300012927|Ga0137416_11427834 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300012957|Ga0164303_10391296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
3300012976|Ga0134076_10222141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300013306|Ga0163162_12623163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300013307|Ga0157372_11776966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300013307|Ga0157372_11777168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300014497|Ga0182008_10459238 | Not Available | 694 | Open in IMG/M |
3300015053|Ga0137405_1059698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1460 | Open in IMG/M |
3300015241|Ga0137418_11075450 | Not Available | 575 | Open in IMG/M |
3300015356|Ga0134073_10154832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300015357|Ga0134072_10015071 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300016319|Ga0182033_12217710 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300016387|Ga0182040_10497248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 974 | Open in IMG/M |
3300017973|Ga0187780_11437068 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300018431|Ga0066655_10279859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
3300018431|Ga0066655_10312418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
3300018468|Ga0066662_10256178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
3300019787|Ga0182031_1409150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4025 | Open in IMG/M |
3300019887|Ga0193729_1094460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
3300020579|Ga0210407_10160032 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
3300021171|Ga0210405_10661434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
3300021559|Ga0210409_10391518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1244 | Open in IMG/M |
3300021560|Ga0126371_11384325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 835 | Open in IMG/M |
3300025917|Ga0207660_11185980 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300025924|Ga0207694_10156618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1838 | Open in IMG/M |
3300025927|Ga0207687_10117661 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
3300025928|Ga0207700_10303624 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300025928|Ga0207700_11578193 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300025941|Ga0207711_11520946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300026325|Ga0209152_10112326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300026343|Ga0209159_1204898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300026532|Ga0209160_1041641 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
3300026538|Ga0209056_10502099 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300027061|Ga0209729_1011663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
3300027775|Ga0209177_10284978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300027846|Ga0209180_10795858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300027875|Ga0209283_10368506 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300027894|Ga0209068_10072397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1782 | Open in IMG/M |
3300028381|Ga0268264_11550909 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300029907|Ga0311329_10011678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8131 | Open in IMG/M |
3300029951|Ga0311371_10156599 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
3300031681|Ga0318572_10720284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 594 | Open in IMG/M |
3300031736|Ga0318501_10705738 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300031890|Ga0306925_11143448 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300031910|Ga0306923_10811022 | Not Available | 1033 | Open in IMG/M |
3300031941|Ga0310912_10650321 | Not Available | 819 | Open in IMG/M |
3300031945|Ga0310913_10415999 | Not Available | 954 | Open in IMG/M |
3300031946|Ga0310910_10206408 | Not Available | 1525 | Open in IMG/M |
3300031946|Ga0310910_10234090 | Not Available | 1433 | Open in IMG/M |
3300031954|Ga0306926_12638402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 547 | Open in IMG/M |
3300031981|Ga0318531_10076548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1453 | Open in IMG/M |
3300032076|Ga0306924_10224335 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
3300032205|Ga0307472_102284155 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300032897|Ga0335071_10627738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
3300033289|Ga0310914_10184046 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
3300034090|Ga0326723_0571170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300034820|Ga0373959_0154206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J18823_103517371 | 3300001686 | Soil | MPRRPPGPKPHFLIGNMPLASPDPLPIFSAWAAEFGDIFYYRAAWLHVYFLN |
Ga0062389_1009223711 | 3300004092 | Bog Forest Soil | MLQRPPGPNPHFLIGNIPLAARNPLAVFSRWAKDYGDIFYYRAGWIHVYFLN |
Ga0062388_1004988563 | 3300004635 | Bog Forest Soil | MLQRPPGPNPHFLIGNIPLAARNPLAVFSRWAKDYGDIFYYRAGWIHVY |
Ga0066677_101023221 | 3300005171 | Soil | MPTINYEFLMLRPPGPKPHFLIGNMPLASRNPLAVFSKWSAEFGDIF |
Ga0070667_1020284531 | 3300005367 | Switchgrass Rhizosphere | MPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAG |
Ga0070709_113148572 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNRPPGPKPKFLIGNMPLASPDPLSIFSAWAREFGDIFYYRAAWLHVYFLN |
Ga0070678_1017517601 | 3300005456 | Miscanthus Rhizosphere | MPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAGWIHVYFLNHPSL |
Ga0070707_1019867931 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTVSIRPPGPPPKFLIGNFPLFSPDPLAVFTRWAREFGDIF |
Ga0070697_1019889271 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRPPGPKPQFIIGNMPLASGDPLSVFEKWAHEFGDIFYYRAL |
Ga0070730_104589602 | 3300005537 | Surface Soil | MLSRPPGPKPHFLIGNMPLASPDPLPIFSSWAAEFGDIFYYRAAWL |
Ga0070696_1001278702 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDIFYYR |
Ga0070693_1012096582 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDIFYY |
Ga0066699_101997051 | 3300005561 | Soil | MTAVSNRRPPGPSPRFLIGNFPLFRRDPLAVFTRWAREFGD |
Ga0066699_102421581 | 3300005561 | Soil | MPIRPPGPKPRFLIGNMPLASPDPLSIFSAWAREFGDIFYYRAAWLHVYF |
Ga0070717_102948292 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRPPGPKPHFPIGNMPLASNDPLGTYLGWAREYGDIFYYR |
Ga0070717_115147471 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMPKLLRPPGPKPQFVIGNVPLAARNPLATLQSWANEYGDI |
Ga0066656_101758362 | 3300006034 | Soil | MPRRPPGPKPHFLIGNMPLASPDPLPIFSAWAAEFGDIFYYRA |
Ga0075017_1000300741 | 3300006059 | Watersheds | MSVALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYY |
Ga0097621_1013437931 | 3300006237 | Miscanthus Rhizosphere | MPVAIQSRPPGPKPHFPIGNFPLAHANPLATFEKWAREFGDIF |
Ga0066653_102834612 | 3300006791 | Soil | MANRRITRPPGPEQHFLIGNFPLGRPDPLAVFTGWAREFGDI |
Ga0066653_104206812 | 3300006791 | Soil | MPNRSITRPPGPRPLFLIGNFPLGSPDPLAVFTGWAREFGD |
Ga0079220_102748972 | 3300006806 | Agricultural Soil | MIRRPPGPKPRFLIGNLPLAGPDPLSVFLKWVQEFGDIFYYRAVWLRVYFL |
Ga0075424_1020321751 | 3300006904 | Populus Rhizosphere | MPQNPLPPGPKPRFLIGNMPLASADPLARFENWARE |
Ga0099830_107390901 | 3300009088 | Vadose Zone Soil | MNRPPGPRPHFIIGNMPLASREPLSVFTKWAAEFGDI |
Ga0099792_103380841 | 3300009143 | Vadose Zone Soil | MPTVSIRPPGPPPKFLIGNFPLFSPDPLAVFTRWAREFGDIFYYRAGWIDV |
Ga0105243_108064312 | 3300009148 | Miscanthus Rhizosphere | MPKTLTHRPPGPKPHFPIGNFPLAHANPLATFEQWTHEFGDIFYYRAGWLPVYFLN |
Ga0105242_103104422 | 3300009176 | Miscanthus Rhizosphere | MKRPPGPKPHFPYGNMPLAGDDPLGTFLGWAREFG |
Ga0105237_119262782 | 3300009545 | Corn Rhizosphere | MPVAIQSRPPGPKPHFPIGNFPLAHANPLATFEKW |
Ga0134062_100134714 | 3300010337 | Grasslands Soil | MANRRITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAG |
Ga0134062_101431752 | 3300010337 | Grasslands Soil | MLRPPGPKPHFLIGNMPLASRNPLAVFSKWSAEFGDIFYYRAAWIQV |
Ga0074046_106755252 | 3300010339 | Bog Forest Soil | MLQRPPVPKPHFLIGNIPLAARDPLAVFSRWAKDYG |
Ga0126370_117470682 | 3300010358 | Tropical Forest Soil | MLRPPGPKPHFIIGNMPLAGHDPLTIFEKWAREYGDIFYYRALWIHVYFL |
Ga0126370_118557542 | 3300010358 | Tropical Forest Soil | MRRPPGPQPHFLIGNMPLAHRDPLGTFEKWAREFGDIFYYR |
Ga0126376_102812162 | 3300010359 | Tropical Forest Soil | MLRPPGPPPHFLIGNLPLAGKDPLATFLAWAREFGDIFYY |
Ga0126372_111338382 | 3300010360 | Tropical Forest Soil | MLRPPGPKPRFLVGNLPLAGRDPLATFLSWAREFGDIFYYRAGWLHVYF |
Ga0134128_132198911 | 3300010373 | Terrestrial Soil | MIRRPPGPKPRFLIGNLPLAGGDPLSVFLKWAQEFGDIFYYRA |
Ga0126381_1000922211 | 3300010376 | Tropical Forest Soil | MLRPPGPKPRFLVGNLPLAGRDPLATFLSWAREFGDIFYYRAGWLHVYFLNHP |
Ga0134126_118707142 | 3300010396 | Terrestrial Soil | MKRPPGPKPHFLIGNMPLANRDPLATFLKWAREFGDIFYYR |
Ga0134124_126614671 | 3300010397 | Terrestrial Soil | MPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDI |
Ga0126383_117353021 | 3300010398 | Tropical Forest Soil | MPQNPLPPGPKPRFLIGNMPLASADPLARFENWAREYG |
Ga0134121_102486073 | 3300010401 | Terrestrial Soil | MIRRPPGPKPRFLIGNLPLAGGDPLSVFLKWAQEFGDIFYYRAVWLRVYFLNHP |
Ga0134121_113722762 | 3300010401 | Terrestrial Soil | MPVAIQSRPPGPKPHFPIGNFPLAHANPLATFEKWAREFGDIFYYRAG |
Ga0137383_108462501 | 3300012199 | Vadose Zone Soil | MLRPPGPKPHFIIGNMPLAAHDPLATFEQWAREFGDIFYYRALW |
Ga0137363_104085171 | 3300012202 | Vadose Zone Soil | MPNRSITRPPGPEPHFLVGNFPLGRPDPLAVFSGWAREFGDIFYYRAG |
Ga0137381_115562732 | 3300012207 | Vadose Zone Soil | MANRRITRPPGPRPHFLIGNFPLGRPDPLAVFTGWAREFGDIF |
Ga0137386_109948853 | 3300012351 | Vadose Zone Soil | MPAPTRDYPPGPKPHFLIGNFPLANRDPLRVFTGWAREFG |
Ga0137373_112103481 | 3300012532 | Vadose Zone Soil | MANRRITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAGWIHVYFLNSPE |
Ga0137416_114278342 | 3300012927 | Vadose Zone Soil | MRRPPGPKPHFLIGNMPLASADPLAVFLGWAREFGDIFYYRAAWI |
Ga0164303_103912961 | 3300012957 | Soil | MPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAGWIHVYFLNHPS |
Ga0134076_102221412 | 3300012976 | Grasslands Soil | VIFVVYQMPNRSITRPPGPEPHFLIGNFPLGSPDPLAVFSGWAREFGDIFYYRAGWIH |
Ga0163162_126231632 | 3300013306 | Switchgrass Rhizosphere | MPAVSRRPPGPPPRFLIGNLPLFNADPLAIYTRWAREFGD |
Ga0157372_117769661 | 3300013307 | Corn Rhizosphere | MPKTLTHRPPGPKPHFPIGNFPLAHANPLATFEQWTHEFGDIFYYRAGWLP |
Ga0157372_117771681 | 3300013307 | Corn Rhizosphere | MPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAR |
Ga0182008_104592381 | 3300014497 | Rhizosphere | MKRPPGPKPHFLIGNMPLASSDPLTEFQTWAREFGDI |
Ga0137405_10596981 | 3300015053 | Vadose Zone Soil | MPAVSRRPPGPPPRFLIGNLPLLFSPDPLAIYTRWAREFGDI |
Ga0137418_110754501 | 3300015241 | Vadose Zone Soil | MKRPPGPKPHFLIGNMPLASSYPLAVFSKWGREFGDIFYYRAAWL |
Ga0134073_101548321 | 3300015356 | Grasslands Soil | MANRRITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAGWIHVY |
Ga0134072_100150712 | 3300015357 | Grasslands Soil | MPNRSITRPPGPKPRFLVGNFPLGRPDPLAVFSGWAREFGDIFY |
Ga0182033_122177101 | 3300016319 | Soil | MQLRPPGPKPHFLIGNIPLANSNPLAVFQRWAAEYGDIFYYR |
Ga0182040_104972482 | 3300016387 | Soil | MLRPSGPKPHFLVGNIPLAGPAPLDTFTRWAAQYGDIFYYRAAWLHVYFLN |
Ga0187780_114370681 | 3300017973 | Tropical Peatland | MLRPPGPKPQFLIGNIPLAGRDPLATYARWAAQYGDIF |
Ga0066655_102798592 | 3300018431 | Grasslands Soil | MPNRSITRPPGPEPHFLIGNFPLGRPYPLAVFTGWAREFDDIFYYRAGWIHV |
Ga0066655_103124181 | 3300018431 | Grasslands Soil | MPNRSITRPPGPEPHFLIGNFPLGRPDPLAVFSGWAREFGDFFYYRAGWIHVYFLNSPEL |
Ga0066662_102561782 | 3300018468 | Grasslands Soil | MRRPPGPRPKFLIGNMPLASRDPLAVLAGWAREFG |
Ga0182031_14091506 | 3300019787 | Bog | MLQRPPGPKPRFLIGNIPLASRDPLAVFRRWAQDYGDIFYYRAGWIHVYF |
Ga0193729_10944601 | 3300019887 | Soil | MPATSHRRPPGPPPRFLVGNFPLFSDDPLAVFSRWAREFGDIFYYRAGWINVYFL |
Ga0210407_101600323 | 3300020579 | Soil | MPAIRRPPGPRPRFIVGQFPLLGDDPLAVFTRWARDFGDIFYYRAGWIHVYFLN |
Ga0210405_106614341 | 3300021171 | Soil | MPALSRRPPGPPPRLLIGNLPLFSSDPLAIYTRWAREFGDIFYYRAGWIDVYFLNHPN |
Ga0210409_103915181 | 3300021559 | Soil | MLPRPPGPRPHFLIGNMPLASRDPLAVFTRWAGEFGDVFY |
Ga0126371_113843251 | 3300021560 | Tropical Forest Soil | MLRPPGPKPRFLIGNIPLVGPNPLDTFTSWAAEYGDIFYYRAAWL |
Ga0207660_111859802 | 3300025917 | Corn Rhizosphere | MLRPPGPKPHFLIGNMPLASRNPLAQFSQWANEFGDIFYYRAAWIHVYF |
Ga0207694_101566181 | 3300025924 | Corn Rhizosphere | MRRPPGPKPHFLIGNMPLASSDSLQTFLRWSQMFGDVFYYRAIWLHVYFLNDPD |
Ga0207687_101176612 | 3300025927 | Miscanthus Rhizosphere | MPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFY |
Ga0207700_103036241 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRRPPGPKPRFLIGNLPLAGGDPLSVFLKWAQEFGDIF |
Ga0207700_115781931 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MFSRPPGPKPHFLIGNMPLASPDPLPIFSAWAAEFGDIFYYRAAWLH |
Ga0207711_115209462 | 3300025941 | Switchgrass Rhizosphere | MPALRRPPGPPIRRLIGNFPLFSPDPLAVFTGWAREFGDIFYYRAGWIHV |
Ga0209152_101123262 | 3300026325 | Soil | MANRRITRPPGPKPRFLVGNFPLGRPDPLAVFSGWAREFGNIIY |
Ga0209159_12048982 | 3300026343 | Soil | MPNRSITRPPGPKPRFLVGNFPLGRPDPLAVFSGWAREFGDIFYYRAGWI |
Ga0209160_10416411 | 3300026532 | Soil | MPNRSITRPPGPEPHFLIGNFPLGRPDPLAVFTGWAREFGDIFYYRAGWIH |
Ga0209056_105020991 | 3300026538 | Soil | MTRNISRRPPGPKPHFIFGNMPLASHDPLAVFSAWAREFGDIFYYRAIWINVFFLNHPDL |
Ga0209729_10116632 | 3300027061 | Forest Soil | MRPRPPGPRPHFLIGNMPLASRNPLAVFTRWAREFG |
Ga0209177_102849782 | 3300027775 | Agricultural Soil | MPAVLRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREF |
Ga0209180_107958582 | 3300027846 | Vadose Zone Soil | MPAVSCRPPGPPPRFLIGNLPLFSSDPLAIYTRWAREFGDI |
Ga0209283_103685062 | 3300027875 | Vadose Zone Soil | MSLRPPGPKPHFLIGNMPLASRNPLAVFSRWAGEYGDL |
Ga0209068_100723971 | 3300027894 | Watersheds | MPAFPHRRPPGPPPRFLIGNFPLFSPDPLAVFTRWAREFGDIFYY |
Ga0268264_115509092 | 3300028381 | Switchgrass Rhizosphere | MKRPPGPKPHFLYGNMPLAGNDPLGTFLLWAREYGDIFY |
Ga0311329_100116781 | 3300029907 | Bog | MLQRPPGPKPRFLIGNIPLASRDPLAVFRRWAQDYGDIFYYRAGWIH |
Ga0311371_101565993 | 3300029951 | Palsa | MLQRPPGPRPRFLIGNLPLASRNPLAVFSRWAKDYGDIFYYRAGWIHVYFLILT |
Ga0318572_107202841 | 3300031681 | Soil | MLRPPGPKPHVLIGNIPLAGQAPLDTFRRWASEYGDVFYY |
Ga0318501_107057382 | 3300031736 | Soil | MLRPSGPKPHFLVGNIPLAGPAPLDTFTRWAAQYGDIFYY |
Ga0306925_111434481 | 3300031890 | Soil | MLCPPSPKPHFLIGNVSLAGPAPLETFTRWASEYGDIFYYRAAW |
Ga0306923_108110221 | 3300031910 | Soil | MLSSAAPKRPPGPKPHFLIGNMPLASPDPLSLFTTWAREFGDMFY |
Ga0310912_106503212 | 3300031941 | Soil | MLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIFY |
Ga0310913_104159992 | 3300031945 | Soil | MLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDF |
Ga0310910_102064081 | 3300031946 | Soil | MLHPPGPKPHFLIGNVPLAGRSPLDTFRRWTAEYGDI |
Ga0310910_102340902 | 3300031946 | Soil | MLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIF |
Ga0306926_126384022 | 3300031954 | Soil | MLRPPGPKPHVLIGNIPLAGQAPLDTFRRWASEYGDVFYYRAAWLHVY |
Ga0318531_100765481 | 3300031981 | Soil | MLRPPGPKPHFLIGNIPLAGPDPLGTFTRWAAEYGDI |
Ga0306924_102243354 | 3300032076 | Soil | MLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIFYYRALWLQVY |
Ga0307472_1022841551 | 3300032205 | Hardwood Forest Soil | MIRRPPGPKPRFLIGNLPLAGPDPLSVFLKWAQEFGDIFYYRAAWLRVYFLNHPDL |
Ga0335071_106277381 | 3300032897 | Soil | MLFPPGPKPRFLIGNVPLFGRDPLGTFARWAAEYGDIFY |
Ga0310914_101840463 | 3300033289 | Soil | MLRRPPGPKPHFLIGNVPLASENPLAVFSCWAKDFGDIFYYRALWLQVYFLNDP |
Ga0326723_0571170_3_152 | 3300034090 | Peat Soil | MPAVLRRPPGPAPRFLIGNLPLFNSDPLAIYTRWAREFGDIFYYRAAWMD |
Ga0373959_0154206_1_117 | 3300034820 | Rhizosphere Soil | MRRPPGPPPRFLIGNLPLFDPDPLAIYTRWAREFGDIFY |
⦗Top⦘ |