Basic Information | |
---|---|
Family ID | F097285 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | DEPTWGDAATTEKEAANEEAKGPVSHSLEWLKSEEGQASIRQNARK |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.04 % |
% of genes from short scaffolds (< 2000 bps) | 94.23 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.038 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.539 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.54% β-sheet: 0.00% Coil/Unstructured: 59.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 72.12 |
PF08240 | ADH_N | 3.85 |
PF13661 | 2OG-FeII_Oxy_4 | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.04 % |
Unclassified | root | N/A | 0.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q02JFJ0E | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
2170459014|G1P06HT02FRJBU | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp. | 590 | Open in IMG/M |
2209111022|2221206555 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300000550|F24TB_10255811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 838 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10087584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
3300002239|JGI24034J26672_10094285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
3300002407|C687J29651_10185866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 669 | Open in IMG/M |
3300004114|Ga0062593_101692379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 691 | Open in IMG/M |
3300004463|Ga0063356_106215947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
3300005332|Ga0066388_106517238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 588 | Open in IMG/M |
3300005337|Ga0070682_100394230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1045 | Open in IMG/M |
3300005354|Ga0070675_100601451 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300005356|Ga0070674_100810789 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300005441|Ga0070700_100774367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
3300005445|Ga0070708_101236183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
3300005459|Ga0068867_101245487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
3300005549|Ga0070704_101945028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
3300005713|Ga0066905_100497742 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300005764|Ga0066903_103387365 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300005764|Ga0066903_105566639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
3300006580|Ga0074049_12427823 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300006604|Ga0074060_10202164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
3300006881|Ga0068865_100428992 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300009177|Ga0105248_11878043 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300009661|Ga0105858_1061326 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300009792|Ga0126374_10905808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
3300010047|Ga0126382_11154317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
3300010047|Ga0126382_12359531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
3300010359|Ga0126376_12092279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300010362|Ga0126377_10075825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3005 | Open in IMG/M |
3300010373|Ga0134128_10645782 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300010375|Ga0105239_10541648 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300010396|Ga0134126_11019988 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300010396|Ga0134126_11187731 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300010398|Ga0126383_10469923 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300010403|Ga0134123_10276736 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
3300011119|Ga0105246_10902951 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300012475|Ga0157317_1000233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2048 | Open in IMG/M |
3300012476|Ga0157344_1020466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
3300012483|Ga0157337_1022859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
3300012495|Ga0157323_1004329 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300012503|Ga0157313_1015957 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300012507|Ga0157342_1001422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1769 | Open in IMG/M |
3300012884|Ga0157300_1069772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300012891|Ga0157305_10002191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2373 | Open in IMG/M |
3300012893|Ga0157284_10008024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1789 | Open in IMG/M |
3300012906|Ga0157295_10000374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5374 | Open in IMG/M |
3300012948|Ga0126375_10784483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
3300012948|Ga0126375_12098602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300012986|Ga0164304_10058618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2132 | Open in IMG/M |
3300012987|Ga0164307_11897434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300014299|Ga0075303_1006200 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300014969|Ga0157376_11788028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
3300015372|Ga0132256_103763441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300015373|Ga0132257_103159288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
3300015374|Ga0132255_100438072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1910 | Open in IMG/M |
3300015374|Ga0132255_103968339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
3300017947|Ga0187785_10341312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
3300017959|Ga0187779_10573241 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300018060|Ga0187765_10845185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300018060|Ga0187765_11142540 | Not Available | 543 | Open in IMG/M |
3300018074|Ga0184640_10423158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300019877|Ga0193722_1068931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
3300022756|Ga0222622_10536584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
3300023260|Ga0247798_1010193 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300024177|Ga0247686_1049041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
3300024254|Ga0247661_1121286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
3300025167|Ga0209642_10591667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 605 | Open in IMG/M |
3300025322|Ga0209641_10316448 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300025905|Ga0207685_10091312 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300025922|Ga0207646_11330759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp. | 626 | Open in IMG/M |
3300025930|Ga0207701_10825680 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300025937|Ga0207669_10658228 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300025938|Ga0207704_10702731 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300025944|Ga0207661_12120442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300026088|Ga0207641_10747645 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300026095|Ga0207676_11044103 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300026142|Ga0207698_11596630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
3300026747|Ga0207587_101320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
3300026879|Ga0207763_1007172 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300027288|Ga0208525_1031176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
3300027447|Ga0207622_100459 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300027717|Ga0209998_10105966 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300027775|Ga0209177_10495255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp. | 508 | Open in IMG/M |
3300028711|Ga0307293_10197472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
3300028782|Ga0307306_10192029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
3300028791|Ga0307290_10066717 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300028828|Ga0307312_10312863 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300028875|Ga0307289_10391870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300031057|Ga0170834_101309194 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300031231|Ga0170824_115142221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300031562|Ga0310886_10263789 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300031573|Ga0310915_10935282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
3300031847|Ga0310907_10277174 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300032180|Ga0307471_101680841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
3300032205|Ga0307472_100023050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3456 | Open in IMG/M |
3300032205|Ga0307472_100747875 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300032828|Ga0335080_10603476 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300032892|Ga0335081_10642957 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300032893|Ga0335069_12749236 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300033004|Ga0335084_10418013 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300033433|Ga0326726_10271259 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
3300033433|Ga0326726_10952075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 833 | Open in IMG/M |
3300033758|Ga0314868_003126 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 5.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Host-Associated | Open in IMG/M |
3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026747 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A3-10 (SPAdes) | Environmental | Open in IMG/M |
3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027447 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G08K4-12 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_05273410 | 2170459005 | Grass Soil | MGRGHDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNA |
2PV_04117440 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MNRPGAIPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK |
2222039934 | 2209111022 | Grass Soil | PKKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK |
F24TB_102558111 | 3300000550 | Soil | AWGDGDDEPTWGDAATTEKQAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK* |
AF_2010_repII_A001DRAFT_100875842 | 3300000793 | Forest Soil | EPVWGDAVTTEKETANEEAKGPVSHSVEWLKSEEGQASLRQNARK* |
JGI24034J26672_100942851 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | TEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
C687J29651_101858662 | 3300002407 | Soil | NWGDGSEEPTWGDAAATQKEAALEEKLAPVSHSREWLRSEEGQTATRQNTRK* |
Ga0062593_1016923792 | 3300004114 | Soil | AWGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQAALRQSARK* |
Ga0063356_1062159472 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQAARK* |
Ga0066388_1065172382 | 3300005332 | Tropical Forest Soil | YRPRAWGEGDDEPTWGDAATTEKETAAEEAKGPVSHSAEWFKSEEGQASTRQKNARK* |
Ga0070682_1003942302 | 3300005337 | Corn Rhizosphere | RPRAWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0070675_1006014512 | 3300005354 | Miscanthus Rhizosphere | EGDDEPTWGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK* |
Ga0070674_1008107892 | 3300005356 | Miscanthus Rhizosphere | EDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0070700_1007743671 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | PRAWGDGDDEPTWGDATATEKEAAAEEAKGPVSHSLEWLKSEEGQASLRQNARK* |
Ga0070708_1012361832 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GDAAETEKEAAAEEAKGPVSHSREWLRSEEGQAAARQSARK* |
Ga0068867_1012454872 | 3300005459 | Miscanthus Rhizosphere | EGDDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0070704_1019450281 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0066905_1004977422 | 3300005713 | Tropical Forest Soil | GDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK* |
Ga0066903_1033873651 | 3300005764 | Tropical Forest Soil | GDDEPTWGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK* |
Ga0066903_1055666391 | 3300005764 | Tropical Forest Soil | WGEGDDEPTWGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK* |
Ga0074049_124278231 | 3300006580 | Soil | DEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0074060_102021641 | 3300006604 | Soil | GDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0068865_1004289922 | 3300006881 | Miscanthus Rhizosphere | TTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0105248_118780431 | 3300009177 | Switchgrass Rhizosphere | EKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0105858_10613261 | 3300009661 | Permafrost Soil | DAKATEKEADKEEQESPVSHSLEWLRSEEGRASTRQSARK* |
Ga0126374_109058082 | 3300009792 | Tropical Forest Soil | WGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK* |
Ga0126382_111543171 | 3300010047 | Tropical Forest Soil | DEPIWGDAAATEKEAAAEEAKGPVSHSKEWLKSEEGQAFTRQKNARK* |
Ga0126382_123595311 | 3300010047 | Tropical Forest Soil | DAAVTEKEAAAEEAEGPVSHSKEWLKSEEGQAFTRQKNAHK* |
Ga0126376_120922791 | 3300010359 | Tropical Forest Soil | GEDEPVWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASLRQNARK* |
Ga0126377_100758251 | 3300010362 | Tropical Forest Soil | TTEKQAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK* |
Ga0134128_106457821 | 3300010373 | Terrestrial Soil | EPTWGDPAETEKEAAKEEARGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0105239_105416482 | 3300010375 | Corn Rhizosphere | AATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0134126_110199881 | 3300010396 | Terrestrial Soil | EAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0134126_111877311 | 3300010396 | Terrestrial Soil | WGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQALLRQSARK* |
Ga0126383_104699232 | 3300010398 | Tropical Forest Soil | WGNGEDEPVWGDPETTEKETAKEEAKGPVSHSIEWLKSEEGQAAARQSARR* |
Ga0134123_102767361 | 3300010403 | Terrestrial Soil | AWGDGDDEPTWGDATATEKEAAAEEAKGPVSHSLEWLKSEEGQASLRQNARK* |
Ga0105246_109029512 | 3300011119 | Miscanthus Rhizosphere | GEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0157317_10002333 | 3300012475 | Arabidopsis Rhizosphere | PAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0157344_10204661 | 3300012476 | Arabidopsis Rhizosphere | AATTEKEAAAEEAKGPVSHSLEWLKAEEGQASTRQKNARK* |
Ga0157337_10228592 | 3300012483 | Arabidopsis Rhizosphere | DAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0157323_10043292 | 3300012495 | Arabidopsis Rhizosphere | ETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0157313_10159572 | 3300012503 | Arabidopsis Rhizosphere | PRAWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0157342_10014221 | 3300012507 | Arabidopsis Rhizosphere | EKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0157300_10697722 | 3300012884 | Soil | DPVETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR* |
Ga0157305_100021911 | 3300012891 | Soil | DPAETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR* |
Ga0157284_100080243 | 3300012893 | Soil | GDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQALLRQSARK* |
Ga0157295_100003741 | 3300012906 | Soil | AWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0126375_107844832 | 3300012948 | Tropical Forest Soil | WGDAVTTEKQAAAEEAKGAVSHSLEWLKSQEGQASIRQKNARK* |
Ga0126375_120986021 | 3300012948 | Tropical Forest Soil | EPVWGDAATTEKETANEEAKGPVSHSLEWLKSDEGQASLRQNARK* |
Ga0164304_100586181 | 3300012986 | Soil | DEPTWGDAATTEKEAANEEAKGPVSHSLEWLKSEEGQASIRQNARK* |
Ga0164307_118974341 | 3300012987 | Soil | PTAWGDGEDEPTWGDPVTTEKEADREEKMAPVSHSLEWLRSEEGRASLRQNARK* |
Ga0075303_10062001 | 3300014299 | Natural And Restored Wetlands | PRAWGDGEDEPTWGDPAETEKETAKEEAQGPVSHSKEWLKSEEGQALLRQSARN* |
Ga0157376_117880282 | 3300014969 | Miscanthus Rhizosphere | TWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0132256_1037634412 | 3300015372 | Arabidopsis Rhizosphere | DEPTWGDPVATEKEADKEEKMAPVSHSLEWLRSEEGRASLRQNARK* |
Ga0132257_1031592881 | 3300015373 | Arabidopsis Rhizosphere | FYRPTAWGDGEDEPTWGDPVATEKEADKEEKMAPVSHSLEWLRSEEGRASLRQNARK* |
Ga0132255_1004380721 | 3300015374 | Arabidopsis Rhizosphere | DPAEIEKEATKEEAQGPVSHSKEWLKSEEGQASLRQSARK* |
Ga0132255_1039683392 | 3300015374 | Arabidopsis Rhizosphere | EKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK* |
Ga0187785_103413121 | 3300017947 | Tropical Peatland | DEPTWGNPEESAKETANEEAKGPVSHSLEWLRAQEEQAPPRHTARK |
Ga0187779_105732412 | 3300017959 | Tropical Peatland | GDAATTAKETAQEEAKGPVSHSLEWLRSEEGKASLRQNARK |
Ga0187765_108451851 | 3300018060 | Tropical Peatland | HTFYRPLNWGNGEEEPVWSDPVTTEKHASMEEAKGPVNHSLEYLRSEEGQAELRAKAGK |
Ga0187765_111425402 | 3300018060 | Tropical Peatland | LTWGAGDEEPVWSDPATTEKHAAMEESMGPVSHSKEWLQSDEGQAEAARERK |
Ga0184640_104231581 | 3300018074 | Groundwater Sediment | DDEPTWGDPVTTEREAAAEEAKGPVSHSSEWLRSEEGRAAARQSARK |
Ga0193722_10689312 | 3300019877 | Soil | WGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK |
Ga0222622_105365841 | 3300022756 | Groundwater Sediment | KEAAAEEAKGPVNHSLEWLKSEEGQASTRQKNARK |
Ga0247798_10101931 | 3300023260 | Soil | AWGDGEDEPTWGDPVETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR |
Ga0247686_10490411 | 3300024177 | Soil | GEGDDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK |
Ga0247661_11212862 | 3300024254 | Soil | EGDDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK |
Ga0209642_105916671 | 3300025167 | Soil | FYRPRNWGDGSEEPTWGDAAATQKEAALEEKLAPVSHSREWLRSEEGQTATRQNTRK |
Ga0209641_103164481 | 3300025322 | Soil | PTWGDAAATQKEAALEEKLAPVSHSREWLRSEEGQTATRQNTRK |
Ga0207685_100913122 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GDASATDKEAANEEAKGPVSHSLEWLKSEEGQASLRQNARK |
Ga0207646_113307592 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RAWGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLRQSARK |
Ga0207701_108256801 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | EPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLRQSARK |
Ga0207669_106582281 | 3300025937 | Miscanthus Rhizosphere | RAWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK |
Ga0207704_107027312 | 3300025938 | Miscanthus Rhizosphere | TTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK |
Ga0207661_121204422 | 3300025944 | Corn Rhizosphere | DDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK |
Ga0207641_107476452 | 3300026088 | Switchgrass Rhizosphere | GEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLGQSARK |
Ga0207676_110441032 | 3300026095 | Switchgrass Rhizosphere | DGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLRQSARK |
Ga0207698_115966302 | 3300026142 | Corn Rhizosphere | PRAWGDGDDEPVWGDASATDKEAANEEAKGPVSHSLEWLKSEEGQASLRQNARK |
Ga0207587_1013202 | 3300026747 | Soil | EKEAAKEEAQGPVSHSREWLKSEEGQASLRQSARR |
Ga0207763_10071721 | 3300026879 | Tropical Forest Soil | DPVITQKVAATEEAMGPVSHSSEWLRSEEGQASLRQKIR |
Ga0208525_10311761 | 3300027288 | Soil | YRPRAWGDGEDEPTWGDPVETAKEAANEEAKGPVSHSLEWLKSEEGQASTRQKNARK |
Ga0207622_1004591 | 3300027447 | Soil | AETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARR |
Ga0209998_101059661 | 3300027717 | Arabidopsis Thaliana Rhizosphere | RPRAWGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSAHR |
Ga0209177_104952552 | 3300027775 | Agricultural Soil | AAATEKEAAIEEAKGPVSHSLEWLRSEEGRASLGQNARK |
Ga0307293_101974722 | 3300028711 | Soil | AWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK |
Ga0307306_101920291 | 3300028782 | Soil | PRAWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK |
Ga0307290_100667172 | 3300028791 | Soil | YRPRAWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK |
Ga0307312_103128632 | 3300028828 | Soil | EPTWGDAAATEKEAAAEEAKGPVSHSIEWLRSEEGRASGRQSARK |
Ga0307289_103918702 | 3300028875 | Soil | RAWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK |
Ga0170834_1013091942 | 3300031057 | Forest Soil | GDGDDEPTWGDAATTEKEAANEEAKGPVSHSLEWLKSEEGQASLRQNAHK |
Ga0170824_1151422212 | 3300031231 | Forest Soil | WGDGEDEPVWGDPVETAKEAANEEAKGPVSHSREWLRSEEGQAAARQNARK |
Ga0310886_102637891 | 3300031562 | Soil | GDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK |
Ga0310915_109352821 | 3300031573 | Soil | PRAWGGGEDEPVWGDPATTEKETASEEAKGPVSHSLEWLKSEEGQASLRPSAGK |
Ga0310907_102771741 | 3300031847 | Soil | IEKEATKEEAQGPVSHSKEWLKSEEGQASLRQSARK |
Ga0307471_1016808411 | 3300032180 | Hardwood Forest Soil | GDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK |
Ga0307472_1000230505 | 3300032205 | Hardwood Forest Soil | TEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK |
Ga0307472_1007478752 | 3300032205 | Hardwood Forest Soil | EKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR |
Ga0335080_106034761 | 3300032828 | Soil | DGEDEPTWGNPDETAKEAANEEAKGPVSHSREWLRSEEGQAAARQNARK |
Ga0335081_106429571 | 3300032892 | Soil | YRPLTGGTGEEEPVWSDPATTEKHAAMEESLGPVSHSKEWLQSEEGQAEMRAKAGK |
Ga0335069_127492361 | 3300032893 | Soil | WGDPAETAKEAANEEAKGPVSHSLEWLRSEEGQAFVRQNARK |
Ga0335084_104180132 | 3300033004 | Soil | DPVATEKEAANEEKMAPVSHSLEWLRSEEGRASLRQNARK |
Ga0326726_102712591 | 3300033433 | Peat Soil | GDPAETAKEAANEEAKGPVSHSIEWLRSEEGQAFVRQNARK |
Ga0326726_109520751 | 3300033433 | Peat Soil | VWGDPVETAKEAANEEAKGPVSHSREWLRSEEGQAAARQNAHK |
Ga0314868_003126_1_120 | 3300033758 | Peatland | PVETAKEAANEEAKGPVSHSREWLRSEEGQAAARLNARK |
⦗Top⦘ |