NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097285

Metagenome / Metatranscriptome Family F097285

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097285
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 46 residues
Representative Sequence DEPTWGDAATTEKEAANEEAKGPVSHSLEWLKSEEGQASIRQNARK
Number of Associated Samples 96
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.539 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.154 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.54%    β-sheet: 0.00%    Coil/Unstructured: 59.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF07690MFS_1 72.12
PF08240ADH_N 3.85
PF136612OG-FeII_Oxy_4 0.96



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02JFJ0EAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
2170459014|G1P06HT02FRJBUAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.590Open in IMG/M
2209111022|2221206555All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300000550|F24TB_10255811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria838Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10087584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria662Open in IMG/M
3300002239|JGI24034J26672_10094285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria559Open in IMG/M
3300002407|C687J29651_10185866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae669Open in IMG/M
3300004114|Ga0062593_101692379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium691Open in IMG/M
3300004463|Ga0063356_106215947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300005332|Ga0066388_106517238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae588Open in IMG/M
3300005337|Ga0070682_100394230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1045Open in IMG/M
3300005354|Ga0070675_100601451All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300005356|Ga0070674_100810789All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300005441|Ga0070700_100774367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria770Open in IMG/M
3300005445|Ga0070708_101236183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300005459|Ga0068867_101245487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300005549|Ga0070704_101945028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300005713|Ga0066905_100497742All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300005764|Ga0066903_103387365All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005764|Ga0066903_105566639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300006580|Ga0074049_12427823All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300006604|Ga0074060_10202164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria549Open in IMG/M
3300006881|Ga0068865_100428992All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300009177|Ga0105248_11878043All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300009661|Ga0105858_1061326All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300009792|Ga0126374_10905808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300010047|Ga0126382_11154317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300010047|Ga0126382_12359531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300010359|Ga0126376_12092279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300010362|Ga0126377_10075825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14623005Open in IMG/M
3300010373|Ga0134128_10645782All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300010375|Ga0105239_10541648All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300010396|Ga0134126_11019988All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300010396|Ga0134126_11187731All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300010398|Ga0126383_10469923All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300010403|Ga0134123_10276736All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300011119|Ga0105246_10902951All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300012475|Ga0157317_1000233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2048Open in IMG/M
3300012476|Ga0157344_1020466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300012483|Ga0157337_1022859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300012495|Ga0157323_1004329All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300012503|Ga0157313_1015957All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300012507|Ga0157342_1001422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1769Open in IMG/M
3300012884|Ga0157300_1069772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300012891|Ga0157305_10002191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2373Open in IMG/M
3300012893|Ga0157284_10008024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1789Open in IMG/M
3300012906|Ga0157295_10000374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14625374Open in IMG/M
3300012948|Ga0126375_10784483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria752Open in IMG/M
3300012948|Ga0126375_12098602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300012986|Ga0164304_10058618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14622132Open in IMG/M
3300012987|Ga0164307_11897434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300014299|Ga0075303_1006200All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300014969|Ga0157376_11788028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria651Open in IMG/M
3300015372|Ga0132256_103763441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300015373|Ga0132257_103159288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300015374|Ga0132255_100438072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1910Open in IMG/M
3300015374|Ga0132255_103968339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300017947|Ga0187785_10341312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria702Open in IMG/M
3300017959|Ga0187779_10573241All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300018060|Ga0187765_10845185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300018060|Ga0187765_11142540Not Available543Open in IMG/M
3300018074|Ga0184640_10423158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300019877|Ga0193722_1068931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria879Open in IMG/M
3300022756|Ga0222622_10536584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria839Open in IMG/M
3300023260|Ga0247798_1010193All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300024177|Ga0247686_1049041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300024254|Ga0247661_1121286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300025167|Ga0209642_10591667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae605Open in IMG/M
3300025322|Ga0209641_10316448All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300025905|Ga0207685_10091312All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300025922|Ga0207646_11330759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.626Open in IMG/M
3300025930|Ga0207701_10825680All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300025937|Ga0207669_10658228All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300025938|Ga0207704_10702731All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300025944|Ga0207661_12120442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300026088|Ga0207641_10747645All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300026095|Ga0207676_11044103All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300026142|Ga0207698_11596630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300026747|Ga0207587_101320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300026879|Ga0207763_1007172All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300027288|Ga0208525_1031176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria646Open in IMG/M
3300027447|Ga0207622_100459All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300027717|Ga0209998_10105966All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300027775|Ga0209177_10495255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.508Open in IMG/M
3300028711|Ga0307293_10197472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300028782|Ga0307306_10192029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300028791|Ga0307290_10066717All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300028828|Ga0307312_10312863All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300028875|Ga0307289_10391870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300031057|Ga0170834_101309194All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300031231|Ga0170824_115142221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300031562|Ga0310886_10263789All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300031573|Ga0310915_10935282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300031847|Ga0310907_10277174All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300032180|Ga0307471_101680841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria789Open in IMG/M
3300032205|Ga0307472_100023050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14623456Open in IMG/M
3300032205|Ga0307472_100747875All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300032828|Ga0335080_10603476All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300032892|Ga0335081_10642957All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300032893|Ga0335069_12749236All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300033004|Ga0335084_10418013All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300033433|Ga0326726_10271259All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300033433|Ga0326726_10952075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria833Open in IMG/M
3300033758|Ga0314868_003126All Organisms → cellular organisms → Bacteria1476Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere5.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.96%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459014Litter degradation PV2EngineeredOpen in IMG/M
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012475Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610Host-AssociatedOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300024177Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026747Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A3-10 (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027447Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G08K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033758Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_052734102170459005Grass SoilMGRGHDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNA
2PV_041174402170459014Switchgrass, Maize And Mischanthus LitterMNRPGAIPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK
22220399342209111022Grass SoilPKKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK
F24TB_1025581113300000550SoilAWGDGDDEPTWGDAATTEKQAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK*
AF_2010_repII_A001DRAFT_1008758423300000793Forest SoilEPVWGDAVTTEKETANEEAKGPVSHSVEWLKSEEGQASLRQNARK*
JGI24034J26672_1009428513300002239Corn, Switchgrass And Miscanthus RhizosphereTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
C687J29651_1018586623300002407SoilNWGDGSEEPTWGDAAATQKEAALEEKLAPVSHSREWLRSEEGQTATRQNTRK*
Ga0062593_10169237923300004114SoilAWGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQAALRQSARK*
Ga0063356_10621594723300004463Arabidopsis Thaliana RhizosphereTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQAARK*
Ga0066388_10651723823300005332Tropical Forest SoilYRPRAWGEGDDEPTWGDAATTEKETAAEEAKGPVSHSAEWFKSEEGQASTRQKNARK*
Ga0070682_10039423023300005337Corn RhizosphereRPRAWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0070675_10060145123300005354Miscanthus RhizosphereEGDDEPTWGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK*
Ga0070674_10081078923300005356Miscanthus RhizosphereEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0070700_10077436713300005441Corn, Switchgrass And Miscanthus RhizospherePRAWGDGDDEPTWGDATATEKEAAAEEAKGPVSHSLEWLKSEEGQASLRQNARK*
Ga0070708_10123618323300005445Corn, Switchgrass And Miscanthus RhizosphereGDAAETEKEAAAEEAKGPVSHSREWLRSEEGQAAARQSARK*
Ga0068867_10124548723300005459Miscanthus RhizosphereEGDDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0070704_10194502813300005549Corn, Switchgrass And Miscanthus RhizosphereATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0066905_10049774223300005713Tropical Forest SoilGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK*
Ga0066903_10338736513300005764Tropical Forest SoilGDDEPTWGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK*
Ga0066903_10556663913300005764Tropical Forest SoilWGEGDDEPTWGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK*
Ga0074049_1242782313300006580SoilDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0074060_1020216413300006604SoilGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0068865_10042899223300006881Miscanthus RhizosphereTTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0105248_1187804313300009177Switchgrass RhizosphereEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0105858_106132613300009661Permafrost SoilDAKATEKEADKEEQESPVSHSLEWLRSEEGRASTRQSARK*
Ga0126374_1090580823300009792Tropical Forest SoilWGDAATTEKETAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK*
Ga0126382_1115431713300010047Tropical Forest SoilDEPIWGDAAATEKEAAAEEAKGPVSHSKEWLKSEEGQAFTRQKNARK*
Ga0126382_1235953113300010047Tropical Forest SoilDAAVTEKEAAAEEAEGPVSHSKEWLKSEEGQAFTRQKNAHK*
Ga0126376_1209227913300010359Tropical Forest SoilGEDEPVWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASLRQNARK*
Ga0126377_1007582513300010362Tropical Forest SoilTTEKQAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK*
Ga0134128_1064578213300010373Terrestrial SoilEPTWGDPAETEKEAAKEEARGPVSHSKEWLKSEEGQASLRQSARK*
Ga0105239_1054164823300010375Corn RhizosphereAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0134126_1101998813300010396Terrestrial SoilEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0134126_1118773113300010396Terrestrial SoilWGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQALLRQSARK*
Ga0126383_1046992323300010398Tropical Forest SoilWGNGEDEPVWGDPETTEKETAKEEAKGPVSHSIEWLKSEEGQAAARQSARR*
Ga0134123_1027673613300010403Terrestrial SoilAWGDGDDEPTWGDATATEKEAAAEEAKGPVSHSLEWLKSEEGQASLRQNARK*
Ga0105246_1090295123300011119Miscanthus RhizosphereGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0157317_100023333300012475Arabidopsis RhizospherePAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0157344_102046613300012476Arabidopsis RhizosphereAATTEKEAAAEEAKGPVSHSLEWLKAEEGQASTRQKNARK*
Ga0157337_102285923300012483Arabidopsis RhizosphereDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0157323_100432923300012495Arabidopsis RhizosphereETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0157313_101595723300012503Arabidopsis RhizospherePRAWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0157342_100142213300012507Arabidopsis RhizosphereEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0157300_106977223300012884SoilDPVETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR*
Ga0157305_1000219113300012891SoilDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR*
Ga0157284_1000802433300012893SoilGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQALLRQSARK*
Ga0157295_1000037413300012906SoilAWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0126375_1078448323300012948Tropical Forest SoilWGDAVTTEKQAAAEEAKGAVSHSLEWLKSQEGQASIRQKNARK*
Ga0126375_1209860213300012948Tropical Forest SoilEPVWGDAATTEKETANEEAKGPVSHSLEWLKSDEGQASLRQNARK*
Ga0164304_1005861813300012986SoilDEPTWGDAATTEKEAANEEAKGPVSHSLEWLKSEEGQASIRQNARK*
Ga0164307_1189743413300012987SoilPTAWGDGEDEPTWGDPVTTEKEADREEKMAPVSHSLEWLRSEEGRASLRQNARK*
Ga0075303_100620013300014299Natural And Restored WetlandsPRAWGDGEDEPTWGDPAETEKETAKEEAQGPVSHSKEWLKSEEGQALLRQSARN*
Ga0157376_1178802823300014969Miscanthus RhizosphereTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0132256_10376344123300015372Arabidopsis RhizosphereDEPTWGDPVATEKEADKEEKMAPVSHSLEWLRSEEGRASLRQNARK*
Ga0132257_10315928813300015373Arabidopsis RhizosphereFYRPTAWGDGEDEPTWGDPVATEKEADKEEKMAPVSHSLEWLRSEEGRASLRQNARK*
Ga0132255_10043807213300015374Arabidopsis RhizosphereDPAEIEKEATKEEAQGPVSHSKEWLKSEEGQASLRQSARK*
Ga0132255_10396833923300015374Arabidopsis RhizosphereEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK*
Ga0187785_1034131213300017947Tropical PeatlandDEPTWGNPEESAKETANEEAKGPVSHSLEWLRAQEEQAPPRHTARK
Ga0187779_1057324123300017959Tropical PeatlandGDAATTAKETAQEEAKGPVSHSLEWLRSEEGKASLRQNARK
Ga0187765_1084518513300018060Tropical PeatlandHTFYRPLNWGNGEEEPVWSDPVTTEKHASMEEAKGPVNHSLEYLRSEEGQAELRAKAGK
Ga0187765_1114254023300018060Tropical PeatlandLTWGAGDEEPVWSDPATTEKHAAMEESMGPVSHSKEWLQSDEGQAEAARERK
Ga0184640_1042315813300018074Groundwater SedimentDDEPTWGDPVTTEREAAAEEAKGPVSHSSEWLRSEEGRAAARQSARK
Ga0193722_106893123300019877SoilWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK
Ga0222622_1053658413300022756Groundwater SedimentKEAAAEEAKGPVNHSLEWLKSEEGQASTRQKNARK
Ga0247798_101019313300023260SoilAWGDGEDEPTWGDPVETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR
Ga0247686_104904113300024177SoilGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK
Ga0247661_112128623300024254SoilEGDDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK
Ga0209642_1059166713300025167SoilFYRPRNWGDGSEEPTWGDAAATQKEAALEEKLAPVSHSREWLRSEEGQTATRQNTRK
Ga0209641_1031644813300025322SoilPTWGDAAATQKEAALEEKLAPVSHSREWLRSEEGQTATRQNTRK
Ga0207685_1009131223300025905Corn, Switchgrass And Miscanthus RhizosphereGDASATDKEAANEEAKGPVSHSLEWLKSEEGQASLRQNARK
Ga0207646_1133075923300025922Corn, Switchgrass And Miscanthus RhizosphereRAWGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLRQSARK
Ga0207701_1082568013300025930Corn, Switchgrass And Miscanthus RhizosphereEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLRQSARK
Ga0207669_1065822813300025937Miscanthus RhizosphereRAWGDGEDEPTWGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK
Ga0207704_1070273123300025938Miscanthus RhizosphereTTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK
Ga0207661_1212044223300025944Corn RhizosphereDDEPTWGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK
Ga0207641_1074764523300026088Switchgrass RhizosphereGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLGQSARK
Ga0207676_1104410323300026095Switchgrass RhizosphereDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGLASLRQSARK
Ga0207698_1159663023300026142Corn RhizospherePRAWGDGDDEPVWGDASATDKEAANEEAKGPVSHSLEWLKSEEGQASLRQNARK
Ga0207587_10132023300026747SoilEKEAAKEEAQGPVSHSREWLKSEEGQASLRQSARR
Ga0207763_100717213300026879Tropical Forest SoilDPVITQKVAATEEAMGPVSHSSEWLRSEEGQASLRQKIR
Ga0208525_103117613300027288SoilYRPRAWGDGEDEPTWGDPVETAKEAANEEAKGPVSHSLEWLKSEEGQASTRQKNARK
Ga0207622_10045913300027447SoilAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARR
Ga0209998_1010596613300027717Arabidopsis Thaliana RhizosphereRPRAWGDGEDEPTWGDPAETEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSAHR
Ga0209177_1049525523300027775Agricultural SoilAAATEKEAAIEEAKGPVSHSLEWLRSEEGRASLGQNARK
Ga0307293_1019747223300028711SoilAWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK
Ga0307306_1019202913300028782SoilPRAWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK
Ga0307290_1006671723300028791SoilYRPRAWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK
Ga0307312_1031286323300028828SoilEPTWGDAAATEKEAAAEEAKGPVSHSIEWLRSEEGRASGRQSARK
Ga0307289_1039187023300028875SoilRAWGEGDDEPTWGDAATTEKEAAAEEAKGPVSHSAEWLKSEEGQASTRQKNARK
Ga0170834_10130919423300031057Forest SoilGDGDDEPTWGDAATTEKEAANEEAKGPVSHSLEWLKSEEGQASLRQNAHK
Ga0170824_11514222123300031231Forest SoilWGDGEDEPVWGDPVETAKEAANEEAKGPVSHSREWLRSEEGQAAARQNARK
Ga0310886_1026378913300031562SoilGDPAETEKEAANEEAQGPVSHSKEWLKSEEGQASLRQSARK
Ga0310915_1093528213300031573SoilPRAWGGGEDEPVWGDPATTEKETASEEAKGPVSHSLEWLKSEEGQASLRPSAGK
Ga0310907_1027717413300031847SoilIEKEATKEEAQGPVSHSKEWLKSEEGQASLRQSARK
Ga0307471_10168084113300032180Hardwood Forest SoilGDAATTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK
Ga0307472_10002305053300032205Hardwood Forest SoilTEKEAAAEEAKGPVSHSLEWLKSEEGQASTRQKNARK
Ga0307472_10074787523300032205Hardwood Forest SoilEKEAAKEEAQGPVSHSKEWLKSEEGQASLRQSARR
Ga0335080_1060347613300032828SoilDGEDEPTWGNPDETAKEAANEEAKGPVSHSREWLRSEEGQAAARQNARK
Ga0335081_1064295713300032892SoilYRPLTGGTGEEEPVWSDPATTEKHAAMEESLGPVSHSKEWLQSEEGQAEMRAKAGK
Ga0335069_1274923613300032893SoilWGDPAETAKEAANEEAKGPVSHSLEWLRSEEGQAFVRQNARK
Ga0335084_1041801323300033004SoilDPVATEKEAANEEKMAPVSHSLEWLRSEEGRASLRQNARK
Ga0326726_1027125913300033433Peat SoilGDPAETAKEAANEEAKGPVSHSIEWLRSEEGQAFVRQNARK
Ga0326726_1095207513300033433Peat SoilVWGDPVETAKEAANEEAKGPVSHSREWLRSEEGQAAARQNAHK
Ga0314868_003126_1_1203300033758PeatlandPVETAKEAANEEAKGPVSHSREWLRSEEGQAAARLNARK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.