 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F096900 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 40 residues |
| Representative Sequence | KTANDPDSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRMV |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.808 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (38.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (81.731 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 15.71% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.81 % |
| All Organisms | root | All Organisms | 45.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002203|metazooDRAFT_1278271 | All Organisms → Viruses | 519 | Open in IMG/M |
| 3300002294|B570J29584_1009330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 621 | Open in IMG/M |
| 3300002835|B570J40625_100441731 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300004461|Ga0066223_1167548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
| 3300004836|Ga0007759_11282108 | Not Available | 889 | Open in IMG/M |
| 3300005581|Ga0049081_10113070 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300005581|Ga0049081_10290914 | Not Available | 565 | Open in IMG/M |
| 3300005582|Ga0049080_10006229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4139 | Open in IMG/M |
| 3300005582|Ga0049080_10107157 | Not Available | 948 | Open in IMG/M |
| 3300005582|Ga0049080_10147482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300005583|Ga0049085_10215084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300006802|Ga0070749_10763299 | Not Available | 514 | Open in IMG/M |
| 3300008262|Ga0114337_1246036 | Not Available | 688 | Open in IMG/M |
| 3300008267|Ga0114364_1063888 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300008450|Ga0114880_1266464 | Not Available | 522 | Open in IMG/M |
| 3300009082|Ga0105099_10024334 | All Organisms → Viruses → Predicted Viral | 3103 | Open in IMG/M |
| 3300009085|Ga0105103_10608984 | Not Available | 621 | Open in IMG/M |
| 3300009085|Ga0105103_10821613 | All Organisms → Viruses | 541 | Open in IMG/M |
| 3300009151|Ga0114962_10056119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2574 | Open in IMG/M |
| 3300009154|Ga0114963_10387363 | Not Available | 761 | Open in IMG/M |
| 3300009154|Ga0114963_10449998 | Not Available | 691 | Open in IMG/M |
| 3300009160|Ga0114981_10713733 | Not Available | 530 | Open in IMG/M |
| 3300009164|Ga0114975_10532811 | Not Available | 631 | Open in IMG/M |
| 3300009165|Ga0105102_10070993 | All Organisms → Viruses → Predicted Viral | 1578 | Open in IMG/M |
| 3300009165|Ga0105102_10455464 | Not Available | 688 | Open in IMG/M |
| 3300009169|Ga0105097_10190359 | Not Available | 1129 | Open in IMG/M |
| 3300009180|Ga0114979_10052684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2551 | Open in IMG/M |
| 3300009183|Ga0114974_10384848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300009184|Ga0114976_10014415 | All Organisms → Viruses → Predicted Viral | 4860 | Open in IMG/M |
| 3300009184|Ga0114976_10178305 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1179 | Open in IMG/M |
| 3300009184|Ga0114976_10223107 | Not Available | 1030 | Open in IMG/M |
| 3300010334|Ga0136644_10650171 | Not Available | 576 | Open in IMG/M |
| 3300010885|Ga0133913_10293944 | All Organisms → Viruses → Predicted Viral | 4308 | Open in IMG/M |
| 3300010885|Ga0133913_11867484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1500 | Open in IMG/M |
| 3300010885|Ga0133913_12989676 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300013004|Ga0164293_10945100 | Not Available | 540 | Open in IMG/M |
| 3300017700|Ga0181339_1041282 | Not Available | 501 | Open in IMG/M |
| 3300017722|Ga0181347_1005431 | Not Available | 4230 | Open in IMG/M |
| 3300017722|Ga0181347_1129666 | Not Available | 700 | Open in IMG/M |
| 3300017722|Ga0181347_1133037 | Not Available | 689 | Open in IMG/M |
| 3300017722|Ga0181347_1171562 | Not Available | 583 | Open in IMG/M |
| 3300017722|Ga0181347_1196287 | Not Available | 532 | Open in IMG/M |
| 3300017723|Ga0181362_1086871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300017747|Ga0181352_1019313 | All Organisms → Viruses → Predicted Viral | 2121 | Open in IMG/M |
| 3300017747|Ga0181352_1024525 | All Organisms → Viruses → Predicted Viral | 1850 | Open in IMG/M |
| 3300017747|Ga0181352_1178069 | Not Available | 553 | Open in IMG/M |
| 3300017754|Ga0181344_1045635 | Not Available | 1314 | Open in IMG/M |
| 3300017754|Ga0181344_1145442 | Not Available | 677 | Open in IMG/M |
| 3300017754|Ga0181344_1152334 | Not Available | 659 | Open in IMG/M |
| 3300017754|Ga0181344_1171497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 615 | Open in IMG/M |
| 3300017754|Ga0181344_1196303 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 567 | Open in IMG/M |
| 3300017754|Ga0181344_1206939 | Not Available | 549 | Open in IMG/M |
| 3300017761|Ga0181356_1199386 | Not Available | 593 | Open in IMG/M |
| 3300017766|Ga0181343_1105296 | Not Available | 799 | Open in IMG/M |
| 3300017766|Ga0181343_1146333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300017766|Ga0181343_1149599 | Not Available | 651 | Open in IMG/M |
| 3300017774|Ga0181358_1044571 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
| 3300017774|Ga0181358_1216750 | Not Available | 618 | Open in IMG/M |
| 3300017777|Ga0181357_1138976 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 901 | Open in IMG/M |
| 3300017777|Ga0181357_1240397 | Not Available | 632 | Open in IMG/M |
| 3300017780|Ga0181346_1198341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300017780|Ga0181346_1290429 | Not Available | 558 | Open in IMG/M |
| 3300017784|Ga0181348_1091658 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300017784|Ga0181348_1142518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300017784|Ga0181348_1309618 | Not Available | 526 | Open in IMG/M |
| 3300017785|Ga0181355_1294513 | Not Available | 611 | Open in IMG/M |
| 3300019784|Ga0181359_1105315 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300020530|Ga0208235_1016337 | Not Available | 922 | Open in IMG/M |
| 3300020536|Ga0207939_1027890 | Not Available | 752 | Open in IMG/M |
| 3300021519|Ga0194048_10125309 | Not Available | 977 | Open in IMG/M |
| 3300022179|Ga0181353_1056436 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300022179|Ga0181353_1135244 | Not Available | 579 | Open in IMG/M |
| 3300022190|Ga0181354_1039768 | Not Available | 1557 | Open in IMG/M |
| 3300022190|Ga0181354_1044659 | Not Available | 1472 | Open in IMG/M |
| 3300022190|Ga0181354_1143995 | Not Available | 750 | Open in IMG/M |
| 3300022407|Ga0181351_1193393 | Not Available | 687 | Open in IMG/M |
| 3300024500|Ga0255143_1003423 | Not Available | 2795 | Open in IMG/M |
| 3300026457|Ga0255160_1038182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300027598|Ga0255121_1074516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300027608|Ga0208974_1005930 | All Organisms → Viruses | 4160 | Open in IMG/M |
| 3300027697|Ga0209033_1161242 | Not Available | 691 | Open in IMG/M |
| 3300027741|Ga0209085_1375042 | Not Available | 519 | Open in IMG/M |
| 3300027759|Ga0209296_1023483 | All Organisms → Viruses → Predicted Viral | 3483 | Open in IMG/M |
| 3300027759|Ga0209296_1098912 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300027785|Ga0209246_10131768 | Not Available | 982 | Open in IMG/M |
| 3300027963|Ga0209400_1144352 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300027963|Ga0209400_1209821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300027969|Ga0209191_1105611 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300027971|Ga0209401_1037387 | All Organisms → Viruses | 2299 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1045530 | All Organisms → Viruses → Predicted Viral | 2383 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1104918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1182711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10259164 | Not Available | 927 | Open in IMG/M |
| 3300031857|Ga0315909_10706722 | Not Available | 653 | Open in IMG/M |
| 3300031951|Ga0315904_10901533 | Not Available | 714 | Open in IMG/M |
| 3300031951|Ga0315904_11063259 | Not Available | 635 | Open in IMG/M |
| 3300031999|Ga0315274_10852028 | Not Available | 957 | Open in IMG/M |
| 3300032046|Ga0315289_10378203 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300032053|Ga0315284_11833736 | Not Available | 624 | Open in IMG/M |
| 3300032053|Ga0315284_12474816 | Not Available | 507 | Open in IMG/M |
| 3300032116|Ga0315903_10174625 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
| 3300032116|Ga0315903_11106504 | Not Available | 543 | Open in IMG/M |
| 3300033233|Ga0334722_10959046 | Not Available | 603 | Open in IMG/M |
| 3300033482|Ga0316627_102670969 | Not Available | 529 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 38.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.19% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.81% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.92% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.96% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.96% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.96% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_12782713 | 3300002203 | Lake | AKTANDPNSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGKMV* |
| B570J29584_10093303 | 3300002294 | Freshwater | ISVKIVNDLDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV* |
| B570J40625_1004417311 | 3300002835 | Freshwater | ANDPDSRINKSLRAWNCKEGGAVRGGGCEVKGKTKGKMV* |
| Ga0066223_11675484 | 3300004461 | Marine | ASDPNSRINKSLRAWNCAEGGYITAADGIAQKGKTKGRIC* |
| Ga0007759_112821081 | 3300004836 | Freshwater Lake | NDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV* |
| Ga0049081_101130704 | 3300005581 | Freshwater Lentic | SRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV* |
| Ga0049081_102909141 | 3300005581 | Freshwater Lentic | DSRINKSLRAWNCAEGGYVTKADGCVKKGKTKGKFV* |
| Ga0049080_100062291 | 3300005582 | Freshwater Lentic | KTANDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV* |
| Ga0049080_101071574 | 3300005582 | Freshwater Lentic | PDSRINKSLRAWNCADGGYVTAADGCATKGKTKGRMV* |
| Ga0049080_101474824 | 3300005582 | Freshwater Lentic | NDPNSRINKSLRAWNCADGGYVTAADGCATKGKTKGRMV* |
| Ga0049085_102150843 | 3300005583 | Freshwater Lentic | NDPNSRINKSLRAWNCAEGGYVNSADGVAQRGKTRGKMY* |
| Ga0070749_107632991 | 3300006802 | Aqueous | KTANNPDSRINKSLRAWNCADGGYVKQADGCATKGKTKGRFV* |
| Ga0114337_12460361 | 3300008262 | Freshwater, Plankton | AKDPNSRINKSLRAWNCAEGGYVNSADGIAQRGKTRGRYL* |
| Ga0114364_10638885 | 3300008267 | Freshwater, Plankton | AKTANDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV* |
| Ga0114880_12664643 | 3300008450 | Freshwater Lake | KTANDPDSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRMV* |
| Ga0105099_100243349 | 3300009082 | Freshwater Sediment | TSAKTANDPNSRINKSLRAWNCKEGGSVKGGGCEVRGKTKGRMV* |
| Ga0105103_106089841 | 3300009085 | Freshwater Sediment | TANDPDSRINKSLRAWNCKEGGSVRGGGCEVRGKTKGKMV* |
| Ga0105103_108216131 | 3300009085 | Freshwater Sediment | SAKTANDPDSRINKSLRAWNCKEGGSVRGGGCEVRGKTKGKMV* |
| Ga0114962_100561191 | 3300009151 | Freshwater Lake | KTANDPDSRINKSLRAWNCAEGGYIKAADGIAQKGKTKGKLC* |
| Ga0114963_103873634 | 3300009154 | Freshwater Lake | RINKSLRAWNCADGGYIKAADGIAQKGKTKGRMC* |
| Ga0114963_104499984 | 3300009154 | Freshwater Lake | TSAKTASDPDSRINKSLRAWNCADGGYVSAADGCASKGKTKGRFV* |
| Ga0114981_107137331 | 3300009160 | Freshwater Lake | DSRINKSLRAWNCAEGGYVSAADGCATKGKTKGRFV* |
| Ga0114975_105328111 | 3300009164 | Freshwater Lake | AKTANDPNSRINKSLRAWNCADGGYVNSADGVAQKGKTKGRFC* |
| Ga0105102_100709936 | 3300009165 | Freshwater Sediment | SAKTANDPDSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGRMV* |
| Ga0105102_104554643 | 3300009165 | Freshwater Sediment | SAKTANDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRRV* |
| Ga0105097_101903591 | 3300009169 | Freshwater Sediment | PDSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGRMV* |
| Ga0114979_100526841 | 3300009180 | Freshwater Lake | PDSRINKSLRVWNCKDGGYVTAADGCATKGKTKGRMV* |
| Ga0114974_103848481 | 3300009183 | Freshwater Lake | NSRINKSLRAWKCADGGYVDAADGCAIKGKTKGRYI* |
| Ga0114976_100144151 | 3300009184 | Freshwater Lake | TSAKTANDPNSRINKSLRAWNCADGGYIKEADGIAQKGKTKGKMC* |
| Ga0114976_101783054 | 3300009184 | Freshwater Lake | TSAKTANDPNSRINKSLRAWNCADGGYVKAADGVAQKGKTKGRMC* |
| Ga0114976_102231071 | 3300009184 | Freshwater Lake | DPDSRINKSLRAWNCADGGYVTKADGCATKGKTKGRFV* |
| Ga0136644_106501711 | 3300010334 | Freshwater Lake | SSKTANDPNSRINKSLRAWNCADGGYVNSADGIAQKGRTKGRMC* |
| Ga0133913_102939448 | 3300010885 | Freshwater Lake | ASDPDSRINKSLRAWNCAEGGYVTKADGCAIKGKTKGKFV* |
| Ga0133913_118674841 | 3300010885 | Freshwater Lake | RINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV* |
| Ga0133913_129896761 | 3300010885 | Freshwater Lake | TSAKTANDPDSRINKSLSAWHCKDGGYVTAADGCATNGKTKGRMV* |
| Ga0164293_109451001 | 3300013004 | Freshwater | SRINKSLRAWNCKEGGTVRGGGCEIRGKTKGKMV* |
| Ga0181339_10412821 | 3300017700 | Freshwater Lake | DPNSRINKSLRAWNCADGGYVTAADGCATKGKTKGRMV |
| Ga0181347_10054311 | 3300017722 | Freshwater Lake | NSRINKSLRAWNCAEGGYVNSADGIAQKGKTRGKMC |
| Ga0181347_11296664 | 3300017722 | Freshwater Lake | SAKTANDPDSRINKSLRAWNCKEGGSVRGGGCEIKGKTKGKMV |
| Ga0181347_11330371 | 3300017722 | Freshwater Lake | TANDPDSRINKSLRAWNCKEGGSVRGGGCEVRGKTKGKMV |
| Ga0181347_11715621 | 3300017722 | Freshwater Lake | DSRINKSLRAWNCKEGGSVRGGGCEVRGKTKGRMV |
| Ga0181347_11962872 | 3300017722 | Freshwater Lake | TSAKTANDPNSRINKSLRAWNCAEGGYITAADGIAQKGKTKGKMC |
| Ga0181362_10868713 | 3300017723 | Freshwater Lake | ANDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV |
| Ga0181352_10193131 | 3300017747 | Freshwater Lake | TANDPDSRINKSLRAWNCADGGYVNAADGCATKGKTKGRMV |
| Ga0181352_10245251 | 3300017747 | Freshwater Lake | AKTANDPNSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRYI |
| Ga0181352_11780691 | 3300017747 | Freshwater Lake | LTSEKTAKDPKSRINKSLRAWNCADGGYVTKADGCATKGKTKGRMI |
| Ga0181344_10456351 | 3300017754 | Freshwater Lake | NDPDSRINKSLRAWNCKEGGSVRGGGCEIKGKTKGKMV |
| Ga0181344_11454421 | 3300017754 | Freshwater Lake | SRINKSLRAWNCADGGYVKQADGCCTKGKTKGRMI |
| Ga0181344_11523344 | 3300017754 | Freshwater Lake | TSAETARDPDSRINKSLRAWNCADGGYVSSADGCVTQGKTKGRFV |
| Ga0181344_11714971 | 3300017754 | Freshwater Lake | TSAKTANDPNSRINKSLRAWNCADGGYIKAADGIAQKGKTKGRMC |
| Ga0181344_11963031 | 3300017754 | Freshwater Lake | TSAKTANDPNSRINKSLRAWNCADGGYVNSADGIAQKGKTKGRIC |
| Ga0181344_12069392 | 3300017754 | Freshwater Lake | GEEGTANDPDSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGKMV |
| Ga0181356_11993862 | 3300017761 | Freshwater Lake | SAKTANDPNSRINKSLRAWNCAEGGYVNSADGIAQKGKTKGRMC |
| Ga0181343_11052961 | 3300017766 | Freshwater Lake | SAKTANDPDSRINKSLRAWNCKEGGAVRGGGCEIKGKTKGKMV |
| Ga0181343_11463331 | 3300017766 | Freshwater Lake | DPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV |
| Ga0181343_11495991 | 3300017766 | Freshwater Lake | SAKTANDPNSRINKSLRAWNCADGGYVNSADGIAQKGKTKGRMC |
| Ga0181358_10445711 | 3300017774 | Freshwater Lake | DSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGKMV |
| Ga0181358_12167501 | 3300017774 | Freshwater Lake | TKTANDPNSRINKSLRAWNCAEGGYIKDADGIAQKGKTKGRMC |
| Ga0181357_11389761 | 3300017777 | Freshwater Lake | NSRINKSLRAWNCAEGGYVNSADGIAQKGKTKGRMC |
| Ga0181357_12403971 | 3300017777 | Freshwater Lake | TANDPNSRINKSLRAWNCADGGYVNSADGIAQKGKTKGRMC |
| Ga0181346_11983411 | 3300017780 | Freshwater Lake | TANDPNSRINKSLRAWNCAEGGYVNSADGIAQKGKTKGRMC |
| Ga0181346_12904293 | 3300017780 | Freshwater Lake | PDSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRMV |
| Ga0181348_10916585 | 3300017784 | Freshwater Lake | AETARDPDSRINKSLRAWNCAEGGYVTQADGCATKGKTKGRFV |
| Ga0181348_11425181 | 3300017784 | Freshwater Lake | KTANDPNSRINKSLRAWNCAEGGYVNSADGIAQRGKTKGRMC |
| Ga0181348_13096182 | 3300017784 | Freshwater Lake | TANDPDSRINKSLRAWNCKEGGSVRGGGCEVKGKTKGKMV |
| Ga0181355_12945131 | 3300017785 | Freshwater Lake | AKTANDPNSRINQSLRAWNCAEGGYIKDADGIAQKGKTKGRMC |
| Ga0181359_11053151 | 3300019784 | Freshwater Lake | TANDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV |
| Ga0208235_10163371 | 3300020530 | Freshwater | PDSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGKMV |
| Ga0207939_10278901 | 3300020536 | Freshwater | PDSRINKSLRAWNCKEGGAVRGGGCEVRGKTKGKMV |
| Ga0194048_101253094 | 3300021519 | Anoxic Zone Freshwater | AKTANDPNSRINKSLRAWNCADGGYVKAADGVAQKGKTKGRMI |
| Ga0181353_10564361 | 3300022179 | Freshwater Lake | AKTANDPDSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGKMV |
| Ga0181353_11352442 | 3300022179 | Freshwater Lake | DPDSRINKSLRAWNCKEGGAVRGGCEIRGKTKGKMI |
| Ga0181354_10397681 | 3300022190 | Freshwater Lake | KTANDPDSRINKSLRAWNCKEGGSVRGGGCEIRGKTKGKMV |
| Ga0181354_10446595 | 3300022190 | Freshwater Lake | ADSRINKSLRAWNCKEGGAVRGGGCEVRGKTKGKMV |
| Ga0181354_11439953 | 3300022190 | Freshwater Lake | RREDPNSRINKSLRAWNCAEGGYISTADGIAQKGKTRGKMC |
| Ga0181351_11933933 | 3300022407 | Freshwater Lake | KSINKSLRAWNCAEGGYVTAADGCATKGKTKGRYI |
| Ga0255143_10034239 | 3300024500 | Freshwater | TANDPNSRINKSLRAWNCKEGGSVRGGGCEVRGKTKGKMI |
| Ga0255160_10381824 | 3300026457 | Freshwater | TANDPDSRINKSLRAWNCADGGYVKAADGCATKGKTKGRMI |
| Ga0255121_10745163 | 3300027598 | Freshwater | NDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV |
| Ga0208974_10059301 | 3300027608 | Freshwater Lentic | NDPDSRINKSLRAWNCADGGYVTAADGCATKGKTKGRMV |
| Ga0209033_11612423 | 3300027697 | Freshwater Lake | SRINKSLRAWNCADGGYVTAADGCATKGKTKGRMV |
| Ga0209085_13750423 | 3300027741 | Freshwater Lake | TSAKTASDPDSRINKSLRAWNCADGGYVSAADGCASKGKTKGRFV |
| Ga0209296_10234839 | 3300027759 | Freshwater Lake | NDPNSRINKSLRAWNCADGGYIKAADGIAQKGKTKGRMC |
| Ga0209296_10989124 | 3300027759 | Freshwater Lake | DSRINKSLRAWNCADGGYVTAADGCATKGKTKGRMV |
| Ga0209246_101317681 | 3300027785 | Freshwater Lake | NDPNSRINKSLRAWNCKEGGAVRGGGCEIRGKTKGKMI |
| Ga0209400_11443524 | 3300027963 | Freshwater Lake | ANDPNSRINKSLRAWNCADGGYVNSADGVAQKGKTKGRFC |
| Ga0209400_12098211 | 3300027963 | Freshwater Lake | SAKTANDPDSRINKSLRAWNCKEGGAVRGGGCEVRGKTKGKMV |
| Ga0209191_11056111 | 3300027969 | Freshwater Lake | NDPNSRINKSLRAWNCADGGYVNSADGVAQKGKTKGRFC |
| Ga0209401_10373871 | 3300027971 | Freshwater Lake | KTANDPDSRINKSLRAWNCADGGYVTAADGCATKGKTKGRMV |
| (restricted) Ga0247832_10455301 | 3300028557 | Freshwater | ANDPNSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRYI |
| (restricted) Ga0247832_11049185 | 3300028557 | Freshwater | SEKTANDPNSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRMV |
| (restricted) Ga0247831_11827111 | 3300028559 | Freshwater | SAKTANDPNSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRMV |
| (restricted) Ga0247840_102591644 | 3300028581 | Freshwater | TANDPNSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRYI |
| Ga0315909_107067223 | 3300031857 | Freshwater | NDPDSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRYI |
| Ga0315904_109015331 | 3300031951 | Freshwater | PNSRINKSLRAWNCKEGGSVRGGGCEVRGKTKGKMI |
| Ga0315904_110632591 | 3300031951 | Freshwater | ANDPNSRINKSLRAWNCNEGGKVRGGGCEVRGKTKGRIV |
| Ga0315274_108520284 | 3300031999 | Sediment | SEKTANDPDSRINKSLRAWNCAEGGYVTAADGCATKGKTKGRMV |
| Ga0315289_103782031 | 3300032046 | Sediment | AKTANDPNSRINKSLRAWNCAEGGYITAADGIAQKGKTKGRMC |
| Ga0315284_118337361 | 3300032053 | Sediment | SRINKSLRAWNCAEGGYITAADGIAQKGKTKGRMC |
| Ga0315284_124748161 | 3300032053 | Sediment | SAKTANDPDSRINKSLRAWNCKDGGYVTAADGCATKGKTKGRMV |
| Ga0315903_101746251 | 3300032116 | Freshwater | KTANDPDSRINKSLRAWNCKEGGSVRGGGCEIRGKTRGKIV |
| Ga0315903_111065041 | 3300032116 | Freshwater | SRINKSLRAWNCAEGGYVTAADGCATKGKTKGRYI |
| Ga0334722_109590461 | 3300033233 | Sediment | KTANDPNSRINKSLRAWNCAEGGYVNSADGIAQKGKTKGRMC |
| Ga0316627_1026709691 | 3300033482 | Soil | AKTANDPNSRINKSLRAWNCKEGGAVRGGGCEVRGKTRGKIV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |