Basic Information | |
---|---|
Family ID | F096880 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | MITRNNDDGSVTFIYESWDELVKSEPKWQPDADLAAKDRADERIWGY |
Number of Associated Samples | 62 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 82.69 % |
% of genes near scaffold ends (potentially truncated) | 22.12 % |
% of genes from short scaffolds (< 2000 bps) | 58.65 % |
Associated GOLD sequencing projects | 57 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (70.192 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (34.615 % of family members) |
Environment Ontology (ENVO) | Unclassified (74.038 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.808 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.00% β-sheet: 10.67% Coil/Unstructured: 61.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF02467 | Whib | 35.58 |
PF00436 | SSB | 8.65 |
PF00145 | DNA_methylase | 4.81 |
PF09250 | Prim-Pol | 4.81 |
PF01844 | HNH | 2.88 |
PF01555 | N6_N4_Mtase | 1.92 |
PF01551 | Peptidase_M23 | 0.96 |
PF00534 | Glycos_transf_1 | 0.96 |
PF05065 | Phage_capsid | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 8.65 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 8.65 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 4.81 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.92 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.92 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.92 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109497248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300002408|B570J29032_109718067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1123 | Open in IMG/M |
3300002408|B570J29032_109946269 | All Organisms → Viruses → Predicted Viral | 4324 | Open in IMG/M |
3300002835|B570J40625_100056647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5456 | Open in IMG/M |
3300002835|B570J40625_100091668 | All Organisms → Viruses → Predicted Viral | 3826 | Open in IMG/M |
3300002835|B570J40625_100126545 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
3300003277|JGI25908J49247_10013192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2542 | Open in IMG/M |
3300003277|JGI25908J49247_10018065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2122 | Open in IMG/M |
3300003393|JGI25909J50240_1087922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300005580|Ga0049083_10052726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1434 | Open in IMG/M |
3300006805|Ga0075464_10016773 | All Organisms → Viruses → Predicted Viral | 3728 | Open in IMG/M |
3300006805|Ga0075464_10085608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1795 | Open in IMG/M |
3300007538|Ga0099851_1223344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300007973|Ga0105746_1035159 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
3300008266|Ga0114363_1002788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9611 | Open in IMG/M |
3300008266|Ga0114363_1007121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5540 | Open in IMG/M |
3300008266|Ga0114363_1020014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2960 | Open in IMG/M |
3300008450|Ga0114880_1268440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300009068|Ga0114973_10000384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33012 | Open in IMG/M |
3300009068|Ga0114973_10266608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300009081|Ga0105098_10317835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300009085|Ga0105103_10170530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
3300009085|Ga0105103_10735957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300009152|Ga0114980_10265982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300009155|Ga0114968_10018314 | All Organisms → Viruses → Predicted Viral | 4861 | Open in IMG/M |
3300009159|Ga0114978_10069540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2372 | Open in IMG/M |
3300009159|Ga0114978_10288866 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
3300009159|Ga0114978_10381052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300009159|Ga0114978_10491291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300009165|Ga0105102_10034252 | All Organisms → Viruses → Predicted Viral | 2152 | Open in IMG/M |
3300009181|Ga0114969_10345664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300009183|Ga0114974_10006805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8421 | Open in IMG/M |
3300009183|Ga0114974_10416402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300009184|Ga0114976_10260651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300009450|Ga0127391_1007996 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300010354|Ga0129333_10761717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300010885|Ga0133913_10991421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2173 | Open in IMG/M |
3300012017|Ga0153801_1051039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300013004|Ga0164293_10727709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300013005|Ga0164292_10545882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10020523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6246 | Open in IMG/M |
3300014811|Ga0119960_1017799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300014811|Ga0119960_1078363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300017736|Ga0181365_1008135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2600 | Open in IMG/M |
3300017736|Ga0181365_1140985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300017761|Ga0181356_1244063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017774|Ga0181358_1001351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11185 | Open in IMG/M |
3300017774|Ga0181358_1078583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
3300017777|Ga0181357_1000476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15143 | Open in IMG/M |
3300017778|Ga0181349_1274158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300019784|Ga0181359_1002724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5218 | Open in IMG/M |
3300019784|Ga0181359_1013876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2944 | Open in IMG/M |
3300019784|Ga0181359_1143568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300020530|Ga0208235_1003163 | All Organisms → Viruses → Predicted Viral | 2481 | Open in IMG/M |
3300020530|Ga0208235_1008235 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
3300020533|Ga0208364_1020140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
3300020553|Ga0208855_1041524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300022407|Ga0181351_1085566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
3300025896|Ga0208916_10000911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13094 | Open in IMG/M |
3300025896|Ga0208916_10029206 | All Organisms → Viruses → Predicted Viral | 2210 | Open in IMG/M |
3300027734|Ga0209087_1015534 | All Organisms → Viruses → Predicted Viral | 3801 | Open in IMG/M |
3300027736|Ga0209190_1080558 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
3300027754|Ga0209596_1001389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20849 | Open in IMG/M |
3300027759|Ga0209296_1006780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7180 | Open in IMG/M |
3300027956|Ga0209820_1095173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
3300027974|Ga0209299_1312104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1058374 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
3300028025|Ga0247723_1000333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32284 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1024751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4460 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1137787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300031857|Ga0315909_10011090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9560 | Open in IMG/M |
3300031857|Ga0315909_10034601 | All Organisms → Viruses → Predicted Viral | 4850 | Open in IMG/M |
3300031857|Ga0315909_10226578 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
3300033993|Ga0334994_0033987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3284 | Open in IMG/M |
3300033993|Ga0334994_0079503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1968 | Open in IMG/M |
3300033993|Ga0334994_0142040 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
3300033993|Ga0334994_0257860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
3300033993|Ga0334994_0381553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300033996|Ga0334979_0479671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300034012|Ga0334986_0122232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1533 | Open in IMG/M |
3300034012|Ga0334986_0340551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300034061|Ga0334987_0029317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4817 | Open in IMG/M |
3300034061|Ga0334987_0070352 | All Organisms → Viruses → Predicted Viral | 2800 | Open in IMG/M |
3300034061|Ga0334987_0144458 | All Organisms → Viruses → Predicted Viral | 1751 | Open in IMG/M |
3300034061|Ga0334987_0643110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300034062|Ga0334995_0003224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16730 | Open in IMG/M |
3300034062|Ga0334995_0026869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5013 | Open in IMG/M |
3300034062|Ga0334995_0049629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3439 | Open in IMG/M |
3300034062|Ga0334995_0054850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3230 | Open in IMG/M |
3300034062|Ga0334995_0268078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
3300034073|Ga0310130_0021425 | All Organisms → Viruses → Predicted Viral | 2058 | Open in IMG/M |
3300034092|Ga0335010_0285909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
3300034101|Ga0335027_0004016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12944 | Open in IMG/M |
3300034101|Ga0335027_0162987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1623 | Open in IMG/M |
3300034101|Ga0335027_0201763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1412 | Open in IMG/M |
3300034101|Ga0335027_0314944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
3300034101|Ga0335027_0736530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300034104|Ga0335031_0361757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300034106|Ga0335036_0140657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1728 | Open in IMG/M |
3300034106|Ga0335036_0151125 | All Organisms → Viruses → Predicted Viral | 1653 | Open in IMG/M |
3300034106|Ga0335036_0198569 | All Organisms → Viruses → Predicted Viral | 1392 | Open in IMG/M |
3300034111|Ga0335063_0147908 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
3300034122|Ga0335060_0068063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2205 | Open in IMG/M |
3300034283|Ga0335007_0223445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 34.62% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.31% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.77% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.81% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.85% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.88% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.88% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 1.92% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.96% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.96% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.96% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.96% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.96% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1094972482 | 3300002408 | Freshwater | MITRKNDDGSLTFIFESWDELLNSEPTWEPDADLAAKDKQDQRIWGY* |
B570J29032_1097180672 | 3300002408 | Freshwater | MITRNNADGSVTFIFESWDELVKSEPSWQPDADLASKDRADERIWGY* |
B570J29032_1099462698 | 3300002408 | Freshwater | MITRNNDDGSVTFIFESWAELIESEPIWEPDADLWAKDRADQRANDY* |
B570J40625_1000566479 | 3300002835 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPTWQPDADLYAKDRADERIWGY* |
B570J40625_10009166811 | 3300002835 | Freshwater | QMITRNNDDGSITFIYESWDELLNSEPSWQPDADLAAKDRADERIWGY* |
B570J40625_1001265453 | 3300002835 | Freshwater | MITRNNDDGSITFIYESWDELLNSEPSWQPDADLAAKDRADERIWGY* |
JGI25908J49247_100131926 | 3300003277 | Freshwater Lake | MITRNNDDGSVTFIFESWDELLNSESKWQPDADLALKDRADERVWGY* |
JGI25908J49247_100180655 | 3300003277 | Freshwater Lake | MITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADERIWGY* |
JGI25909J50240_10879221 | 3300003393 | Freshwater Lake | RNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADERIWGY* |
Ga0049083_100527265 | 3300005580 | Freshwater Lentic | QMITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADERIWGY* |
Ga0075464_100167736 | 3300006805 | Aqueous | MITRNNDDGSVTFIFESWDELVKSEPKWQPDADLAAKDRADERIWAY* |
Ga0075464_100856083 | 3300006805 | Aqueous | MITRNNEDGSVTFIYESWDELVKSEPSWTPDSDLLAKDRADERIWGY* |
Ga0099851_12233442 | 3300007538 | Aqueous | MITKKNDDGSLTFIYESWDELLNSEPTWQPDADLAAKDREDERIWGY* |
Ga0105746_10351594 | 3300007973 | Estuary Water | MITRNNDDGSVTFIYESWDEYLKSEPKWQPDADLALKDRADERIWGY* |
Ga0114363_10027888 | 3300008266 | Freshwater, Plankton | MITRKNDDGSVTFIYESWDELVKSEPSWQPDSDLYAKDREDERIWGY* |
Ga0114363_10071215 | 3300008266 | Freshwater, Plankton | MITKKNDDGSLTFIYESWDELLNSESTWQPDPDLFAKDREDERIWGY* |
Ga0114363_10200142 | 3300008266 | Freshwater, Plankton | MITRNNADGSITFIYESWDELLNQEPSWQPDPNLAAKDRADERIWGY* |
Ga0114880_12684401 | 3300008450 | Freshwater Lake | MITRNNDDGSITFIYESWDELLNSEPKWQPDADLAAKDRADERVWGY* |
Ga0114973_1000038415 | 3300009068 | Freshwater Lake | MITRNNADGSVTFIYESWDELVKSEPKWQPDADLAAKDRADERSWDY* |
Ga0114973_102666083 | 3300009068 | Freshwater Lake | MITRNNPDGSVTFVFESWAELVKSEPTYEPDPDLRAKDRADERIWGY* |
Ga0105098_103178352 | 3300009081 | Freshwater Sediment | MITRNNADGSITFIYESWDELLNSEPSWQPDADLAAKDRADERIWGY* |
Ga0105103_101705303 | 3300009085 | Freshwater Sediment | MITRNNDDGSVTFIFESWDELLNSEPKWEPDADLASKDRADQRIWGY* |
Ga0105103_107359572 | 3300009085 | Freshwater Sediment | MITRNNADGSITFVYESWDELLNSEPKWQPDVDLAAKDRADERVWGY* |
Ga0114980_102659821 | 3300009152 | Freshwater Lake | MITRKNDDGSVTFVFESWDELVKSEATWEPDGDLALKDKADERIWGY* |
Ga0114968_1001831410 | 3300009155 | Freshwater Lake | MITRNNPDGSVTFIYESWDELVKSEPTYEPDSDLLAKDRADERIWGY* |
Ga0114978_100695402 | 3300009159 | Freshwater Lake | MITRNNADGSVTFVFESWAELVKSEPTYEPDADLRAKDRADERIWGY* |
Ga0114978_102888662 | 3300009159 | Freshwater Lake | MITRNNADGSVTFLFESWDELVKSEPSWQPDADLASKDRADERIWGY* |
Ga0114978_103810523 | 3300009159 | Freshwater Lake | MITRKNDDGSVTFIFESWDELIKSEPKWEPDYDLQLKDRQDAGIWGY* |
Ga0114978_104912911 | 3300009159 | Freshwater Lake | DGSVTFVFESWAELVKSEPTYEPDADLRAKDRADERIWGY* |
Ga0105102_100342526 | 3300009165 | Freshwater Sediment | TFIYESWDELLNSEPSWQLDADLAAKDRADERIWGY* |
Ga0114969_103456643 | 3300009181 | Freshwater Lake | MITRNNADGSVTFIYESWDELVKSEPKWQPDADLAAKDRADE |
Ga0114974_1000680520 | 3300009183 | Freshwater Lake | MITRNNDDGSVTFIFESWDELVKSEPKWQPDADLASKDRADERIWGY* |
Ga0114974_104164023 | 3300009183 | Freshwater Lake | MITRNNDDGSVTFVFESWAELLKSEPTYEPDSDLYAKDRADERSWGY* |
Ga0114976_102606512 | 3300009184 | Freshwater Lake | MITRNNPDGSVTFIYESWDELVKSEPKWQPDADLASKDRADERIWGY* |
Ga0127391_10079965 | 3300009450 | Meromictic Pond | MITRKNDDGSITFIYESWEEILNTQSTYEPDPDLYLKDRADERLWGY* |
Ga0129333_107617172 | 3300010354 | Freshwater To Marine Saline Gradient | MITRNNDDGSVTFIFESWAELIKSEPKWEPDADLWAKDRADQRANDY* |
Ga0133913_109914213 | 3300010885 | Freshwater Lake | MITRNNADGSVTFVFESWAELVKSEPTYEPDSDLLAKDRADERIWGY* |
Ga0153801_10510392 | 3300012017 | Freshwater | MIERHNEDGSITFVYESWDEFLKQEPKWQPDPDLAAKDRADERIWGY* |
Ga0164293_107277092 | 3300013004 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPKWQPDADLAAKDRADERIWGY* |
Ga0164292_105458822 | 3300013005 | Freshwater | MITRNNEDGSVTFIYESWDELVKSEPKWQPDADLAAKDRADERIWGY* |
(restricted) Ga0172367_1002052313 | 3300013126 | Freshwater | MITRHNEDGSITFIYESWDELLNFEPSWQPDADLAAKDREDERIWGY* |
Ga0119960_10177993 | 3300014811 | Aquatic | MIERHNEDGSITFVYESWDEFLKQEPKWQPDPDLAATDRDWETIRS |
Ga0119960_10783632 | 3300014811 | Aquatic | MITRNNDDGSVTFIYESWAELVKSEPTYEPDPDLRAKDRADERIWGY* |
Ga0181365_10081351 | 3300017736 | Freshwater Lake | MITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRALF |
Ga0181365_11409851 | 3300017736 | Freshwater Lake | QMITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADERMWGY |
Ga0181356_12440632 | 3300017761 | Freshwater Lake | MITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLKAKDRADERIWGY |
Ga0181358_10013519 | 3300017774 | Freshwater Lake | MITRNNDDGSVTFIFESWDELLNSESKWQPDADLALKDRANERVWGY |
Ga0181358_10785834 | 3300017774 | Freshwater Lake | ALSSREKQMITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADERIWGY |
Ga0181357_10004768 | 3300017777 | Freshwater Lake | MITRNNDDGSVTFIFESWDELLNSESKWQPDADLALKDRADEKVWGY |
Ga0181349_12741582 | 3300017778 | Freshwater Lake | WAQQMITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADERIWGY |
Ga0181359_10027248 | 3300019784 | Freshwater Lake | MITRNNDDGSVTFIFESWDELLNSESKWQPDADLALKDRADERVWGY |
Ga0181359_10138767 | 3300019784 | Freshwater Lake | MITRNNDDGSVTFIYESWDEFLNYEPKWQPDPDLRAKDRADERIWGY |
Ga0181359_11435684 | 3300019784 | Freshwater Lake | ALSAWAQQMITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADERIWGY |
Ga0208235_10031634 | 3300020530 | Freshwater | MITRNNADGSITFIYESWDELLNSEPSWQPDADLAAKDRADERIWGY |
Ga0208235_10082354 | 3300020530 | Freshwater | MITRNNADGSVTFIFESWDELVKSEPSWQPDADLASKDRADERIWGY |
Ga0208364_10201402 | 3300020533 | Freshwater | MITRNNDDGSITFIYESWDELLNSEPSWQPDADLASKDRADERIWGY |
Ga0208855_10415242 | 3300020553 | Freshwater | MITRNNADGSVTFIFESWDELVKSEPSWQPDADLASKDRAHQRIWGY |
Ga0181351_10855663 | 3300022407 | Freshwater Lake | MITRNNDDGSVTFIYESWDELLNYEPKWQPDPDLRAKDRADE |
Ga0208916_1000091119 | 3300025896 | Aqueous | MITRNNEDGSVTFIYESWDELVKSEPSWTPDSDLLAKDRADERIWGY |
Ga0208916_100292065 | 3300025896 | Aqueous | MITRNNDDGSVTFIFESWDELVKSEPKWQPDADLAAKDRADERIWAY |
Ga0209087_10155345 | 3300027734 | Freshwater Lake | MITRNNADGSVTFVFESWAELVKSEPTYEPDADLRAKDRADERIWGY |
Ga0209190_10805583 | 3300027736 | Freshwater Lake | MITRNNADGSVTFVFESWAELVKSEPTYEPDSDLLAKDRSDERIWGY |
Ga0209596_100138931 | 3300027754 | Freshwater Lake | MITRNNPDGSVTFIYESWDELVKSEPTYEPDSDLLAKDRADERIWGY |
Ga0209296_10067809 | 3300027759 | Freshwater Lake | MITRNNDDGSVTFIFESWDELVKSEPKWQPDADLASKDRADERIWGY |
Ga0209820_10951733 | 3300027956 | Freshwater Sediment | GSITFIYESWDELLNSEPSWQPDADLAAKDRADERIWGY |
Ga0209299_13121042 | 3300027974 | Freshwater Lake | MITRKNDDGSVTFVFESWDELVKSEATWEPDGDLALKDKADERIWGY |
(restricted) Ga0247834_10583744 | 3300027977 | Freshwater | MITRHNDDGSVTFIYESWDELVKSEPMWEPDADLQRKDRADERVWGY |
Ga0247723_100033310 | 3300028025 | Deep Subsurface Sediment | MITRKNDDGSITFIYESWDELVKSEPTWQPDADLYSKDRADERIWGY |
(restricted) Ga0247843_10247516 | 3300028569 | Freshwater | MITRHNDDGSITFIYESWDELLKQEPSWQPDSDLIAKDRADERIWGY |
(restricted) Ga0247843_11377873 | 3300028569 | Freshwater | MITRNNDDGSVTFIYESWDELVKSEPKWQPDADLAAKDRADERIWGY |
Ga0315909_1001109016 | 3300031857 | Freshwater | MITRKNDDGSVTFIYESWDELVKSEPSWQPDSDLYAKDREDERIWGY |
Ga0315909_1003460111 | 3300031857 | Freshwater | MITKKNDDGSLTFIYESWDELLNSESTWQPDPDLFAKDREDERIWGY |
Ga0315909_102265783 | 3300031857 | Freshwater | MITRNNADGSITFIYESWDELLNQEPSWQPDPNLAAKDRADERIWGY |
Ga0334994_0033987_3070_3213 | 3300033993 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPKWQPDADLAAKDRADERIWGY |
Ga0334994_0079503_390_533 | 3300033993 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPTWQPDADLYAKDRADERIWGY |
Ga0334994_0142040_1222_1359 | 3300033993 | Freshwater | TRNNDDGSITFIYESWDELLNSEPSWQPDADLAAKDRADERIWGY |
Ga0334994_0257860_677_820 | 3300033993 | Freshwater | MITRKNDDGSLTFIFESWDELLNSEPTWEPDADLAAKDKQDQRIWGY |
Ga0334994_0381553_337_480 | 3300033993 | Freshwater | MITRNNDDGSVTFIFESWAELIESEPIWEPDADLWAKDRADQRANDY |
Ga0334979_0479671_3_113 | 3300033996 | Freshwater | MTFIYESWDELLNSQPTWEPDADLHRKDRADERVWGY |
Ga0334986_0122232_1188_1331 | 3300034012 | Freshwater | MIERHNEDGSITFVYESWDELLNQEPKWQPDPDLAAKDRADERIWGY |
Ga0334986_0340551_24_167 | 3300034012 | Freshwater | MITRNNEDGSVTFIYESWDELVKSEPKWQPDADLAAKDRADERIWGY |
Ga0334987_0029317_3449_3592 | 3300034061 | Freshwater | MITRNNADGSVTFIFESWDELVQSEPSWQPDDDLASKDRADERIWGY |
Ga0334987_0070352_1150_1293 | 3300034061 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPEWQPDADLAAKDRADERIWGY |
Ga0334987_0144458_3_137 | 3300034061 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPTWEPDGDLASKDRADQRIW |
Ga0334987_0643110_354_497 | 3300034061 | Freshwater | MITRKNEDGSITFIYESWDELIKSEPTWEPDADLRAKDRNDERIWGY |
Ga0334995_0003224_3_122 | 3300034062 | Freshwater | MITRNNDDGSITFIYESWDELLNSEPSWQPDADLAAKDRA |
Ga0334995_0026869_308_457 | 3300034062 | Freshwater | MKTRKNDDGSITFIFESWDELMDDFDEPSWVPDGDLARKDRADERIWGY |
Ga0334995_0049629_97_240 | 3300034062 | Freshwater | MITRNNADGSITFIYESWDELLNSEPSWQPDADLATKDRADERVWGY |
Ga0334995_0054850_2418_2561 | 3300034062 | Freshwater | MIQKHNEDGSITFVYESWDELLNQEPKWQPDPDLAAKDRADERIWGY |
Ga0334995_0268078_649_792 | 3300034062 | Freshwater | MITRNNDDGSVTFIFESWDEYLKSEPKWQPDADLASKDRADERIWGY |
Ga0310130_0021425_1429_1572 | 3300034073 | Fracking Water | MITTKNADGSVTFIYESWDELLNSEPSWQPDADLAAKDRADERIWGY |
Ga0335010_0285909_3_140 | 3300034092 | Freshwater | TRNNDDGSVTFIFESWDEYLKSEPKWQPDADLASKDRADERIWGY |
Ga0335027_0004016_9411_9554 | 3300034101 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPKWQPDADLAAKDRADERIWDY |
Ga0335027_0162987_598_741 | 3300034101 | Freshwater | MITRNNDDGSVTFIFESWDELVKSEPTWEPDGDLASKDRADQRTWGY |
Ga0335027_0201763_1215_1358 | 3300034101 | Freshwater | MITRNNADGSVTFIFESWDELVKSESSWQPDADLASKDRADERIWGY |
Ga0335027_0314944_1_138 | 3300034101 | Freshwater | MIQKHNEDGSITFVYESWDELLNQEPKWQPDPDLAAKDRADERIWG |
Ga0335027_0736530_328_471 | 3300034101 | Freshwater | MITRNNDDGSITFIYESWDELLNSEPSWQPDSDLAAKDCADERIWGY |
Ga0335031_0361757_787_924 | 3300034104 | Freshwater | MITRNNADGSVTFIFESWDELFKSEPSWQPDADLASKDRADERIWG |
Ga0335036_0140657_1390_1533 | 3300034106 | Freshwater | MITRNNDDGSVTFIYESWDEYLKSEPKWQPDADLALKDRADERIWGY |
Ga0335036_0151125_1297_1440 | 3300034106 | Freshwater | MITRNNEDGSVTFIYESWDELIKSEPKWEPDADLWAKDRADERAWDY |
Ga0335036_0198569_218_361 | 3300034106 | Freshwater | MITRNNDDGSITFIYESWDELLNSEPSWQPDADLAGKDRADERVWGY |
Ga0335063_0147908_127_270 | 3300034111 | Freshwater | MITRNNDDGSVTFIYESWDELLNSEPTWEPDADLHRKDRADERVWGY |
Ga0335060_0068063_3_134 | 3300034122 | Freshwater | MITRNNEDGSVTFIYESWDELVKSEPKWQPDADLAAKDRADERI |
Ga0335007_0223445_106_249 | 3300034283 | Freshwater | MIERNNADGSITFVYESWDELLNSEPKWQPDADLAAKDRADERVWGY |
⦗Top⦘ |