NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096811

Metagenome Family F096811

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096811
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 53 residues
Representative Sequence PEFAAEAKKLLDWDGATYLSGEQLQKKIEATVTQPPDVIKRVKEVLEES
Number of Associated Samples 97
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.77 %
% of genes near scaffold ends (potentially truncated) 82.69 %
% of genes from short scaffolds (< 2000 bps) 86.54 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.154 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.577 % of family members)
Environment Ontology (ENVO) Unclassified
(36.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(33.654 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.96%    β-sheet: 2.60%    Coil/Unstructured: 58.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF09587PGA_cap 21.15
PF03401TctC 7.69
PF00890FAD_binding_2 6.73
PF03972MmgE_PrpD 4.81
PF09084NMT1 3.85
PF05016ParE_toxin 1.92
PF00507Oxidored_q4 1.92
PF00296Bac_luciferase 1.92
PF01797Y1_Tnp 0.96
PF13378MR_MLE_C 0.96
PF13343SBP_bac_6 0.96
PF00346Complex1_49kDa 0.96
PF07927HicA_toxin 0.96
PF13531SBP_bac_11 0.96
PF13416SBP_bac_8 0.96
PF01936NYN 0.96
PF02661Fic 0.96
PF00378ECH_1 0.96
PF10531SLBB 0.96
PF00596Aldolase_II 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 7.69
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 4.81
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.85
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.85
COG0838NADH:ubiquinone oxidoreductase subunit 3 (chain A)Energy production and conversion [C] 1.92
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.92
COG0649NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)Energy production and conversion [C] 0.96
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 0.96
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.96
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.96
COG3261Ni,Fe-hydrogenase III large subunitEnergy production and conversion [C] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.15 %
UnclassifiedrootN/A3.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002124|C687J26631_10021765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2277Open in IMG/M
3300002223|C687J26845_10273132All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300003890|Ga0063162_1004986All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300004009|Ga0055437_10258097All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300004011|Ga0055460_10283184All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300004013|Ga0055465_10348022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300004780|Ga0062378_10099587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300005166|Ga0066674_10356294All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium686Open in IMG/M
3300005213|Ga0068998_10060712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M
3300005295|Ga0065707_10799177All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005328|Ga0070676_11357410All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300005340|Ga0070689_100301874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1333Open in IMG/M
3300005540|Ga0066697_10303228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium939Open in IMG/M
3300005545|Ga0070695_101604988All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300005615|Ga0070702_100855241All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium708Open in IMG/M
3300005844|Ga0068862_100435486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1233Open in IMG/M
3300006845|Ga0075421_101784912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300006847|Ga0075431_101188580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium726Open in IMG/M
3300006847|Ga0075431_102021694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300006853|Ga0075420_101211312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300006894|Ga0079215_10053127All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300007255|Ga0099791_10458941All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300009012|Ga0066710_100538324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1765Open in IMG/M
3300009053|Ga0105095_10832078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300009078|Ga0105106_11171761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300009153|Ga0105094_10130803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1425Open in IMG/M
3300009174|Ga0105241_12110102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300009176|Ga0105242_12483711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300009610|Ga0105340_1049353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1642Open in IMG/M
3300009678|Ga0105252_10428869All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300009792|Ga0126374_11061835All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300010043|Ga0126380_11576575All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300010046|Ga0126384_12100116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300010359|Ga0126376_11059274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium816Open in IMG/M
3300010360|Ga0126372_11445730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium721Open in IMG/M
3300010366|Ga0126379_10686040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1117Open in IMG/M
3300010376|Ga0126381_103261682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300010399|Ga0134127_10223843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1764Open in IMG/M
3300010399|Ga0134127_12651807All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300010401|Ga0134121_10960996All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium835Open in IMG/M
3300010403|Ga0134123_11546414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300010403|Ga0134123_12989539Not Available542Open in IMG/M
3300012034|Ga0137453_1063507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium692Open in IMG/M
3300012199|Ga0137383_11341104All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012202|Ga0137363_10136767All Organisms → cellular organisms → Bacteria → Nitrospirae1911Open in IMG/M
3300012231|Ga0137465_1135849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300012232|Ga0137435_1077210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium991Open in IMG/M
3300012582|Ga0137358_10153876All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1566Open in IMG/M
3300012922|Ga0137394_11591227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300012930|Ga0137407_10064858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum3019Open in IMG/M
3300014255|Ga0075320_1018707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300014864|Ga0180068_1060450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300014872|Ga0180087_1096891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300014880|Ga0180082_1160906All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300014883|Ga0180086_1008900All Organisms → cellular organisms → Bacteria → Proteobacteria2087Open in IMG/M
3300015254|Ga0180089_1093399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300016371|Ga0182034_11483875All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300016387|Ga0182040_11131833All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300018000|Ga0184604_10024247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1477Open in IMG/M
3300018028|Ga0184608_10118930Not Available1119Open in IMG/M
3300018052|Ga0184638_1326135All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300018053|Ga0184626_10049498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1758Open in IMG/M
3300018063|Ga0184637_10343499All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300018073|Ga0184624_10146406All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300018075|Ga0184632_10034100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2179Open in IMG/M
3300018079|Ga0184627_10224802All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium990Open in IMG/M
3300018422|Ga0190265_10052148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3575Open in IMG/M
3300018429|Ga0190272_11314643All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300018429|Ga0190272_12397327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300018432|Ga0190275_10010279All Organisms → cellular organisms → Bacteria6902Open in IMG/M
3300018466|Ga0190268_10207972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1076Open in IMG/M
3300018469|Ga0190270_10020136All Organisms → cellular organisms → Bacteria → Proteobacteria4093Open in IMG/M
3300018481|Ga0190271_12845268Not Available581Open in IMG/M
3300019789|Ga0137408_1400605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1267Open in IMG/M
3300019881|Ga0193707_1108617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium820Open in IMG/M
3300019889|Ga0193743_1016601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3928Open in IMG/M
3300020034|Ga0193753_10286179All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300020060|Ga0193717_1030262All Organisms → cellular organisms → Bacteria2126Open in IMG/M
3300020197|Ga0194128_10092931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1906Open in IMG/M
3300020200|Ga0194121_10564843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300022756|Ga0222622_10835897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300025146|Ga0209322_10124887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1161Open in IMG/M
3300025155|Ga0209320_10085311All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300025159|Ga0209619_10040684All Organisms → cellular organisms → Bacteria2959Open in IMG/M
3300025160|Ga0209109_10039205All Organisms → cellular organisms → Bacteria2541Open in IMG/M
3300025167|Ga0209642_10058143All Organisms → cellular organisms → Bacteria2235Open in IMG/M
3300025167|Ga0209642_10265023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium982Open in IMG/M
3300025318|Ga0209519_10545390All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300025324|Ga0209640_10097463All Organisms → cellular organisms → Bacteria2535Open in IMG/M
3300025324|Ga0209640_10229780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1569Open in IMG/M
3300025327|Ga0209751_10410637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1122Open in IMG/M
3300025560|Ga0210108_1059163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium739Open in IMG/M
3300025780|Ga0210100_1072461Not Available508Open in IMG/M
3300025936|Ga0207670_10558448All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300027462|Ga0210000_1009616All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300027722|Ga0209819_10099243All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300027909|Ga0209382_10908589All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300027909|Ga0209382_11194104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium779Open in IMG/M
3300032075|Ga0310890_11680553All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300032180|Ga0307471_100039716All Organisms → cellular organisms → Bacteria3753Open in IMG/M
3300033407|Ga0214472_10295737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1541Open in IMG/M
3300034147|Ga0364925_0256227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300034150|Ga0364933_129943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300034151|Ga0364935_0227722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.58%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil6.73%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.85%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.92%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.96%
Hot Spring SedimentsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.96%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300002223Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2EnvironmentalOpen in IMG/M
3300003890Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cmEnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025560Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C687J26631_1002176523300002124SoilLQALRESFERMLKDPEFAAEAKKLLDWDGMTFLSGEQLQRKFEANVIQPPDVIKRVKEVLEKS*
C687J26845_1027313223300002223SoilESFERMLKDPEFAAEAKKLLDWDGMTFLSGEQLQRKFEANVIQPPDVIKRVKEVLEKS*
Ga0063162_100498613300003890Hot Spring SedimentsESFARMLKDSDFAAEAKKFLDWDGVTSLSGAELEKKMIDTITQPPGLIKRIKDVLAES*
Ga0055437_1025809713300004009Natural And Restored WetlandsRMLKDPEFGAHAKKLLDWDGETFMNGDKLQKKIDATVTQPPSVIKLVKEVLAEP*
Ga0055460_1028318423300004011Natural And Restored WetlandsILRDSFERMLKDPEFGAHAKKLLDWDGETFMNGDKLQKKIDATVTQPPSVIKLVKEVLAEP*
Ga0055465_1034802223300004013Natural And Restored WetlandsDRAQILRDSFTKMLKDAEFTAEARKLLDWDGSSHMTGEQLQRKIAETMNQPADVIKRIKEILTQQ*
Ga0062378_1009958713300004780Wetland SedimentSFERMLKDSEFSAEAKKLLDWDGTTFLSGEQLQKKIIATVSQPPDVIKRVKEIMSE*
Ga0066674_1035629423300005166SoilEAKKLLDWNGTTYLSGEDLRRKIDATVSQPPDVIRRVQEVLAES*
Ga0068998_1006071213300005213Natural And Restored WetlandsPEFGAEAKKQLDWDGNTFLTGDQMRQKIEATVTQPPEVIKRIKEVLAEE*
Ga0065707_1079917723300005295Switchgrass RhizosphereERLQILRESFERMLKDTEFAAEAKKLLDWDGTTYLSGDQLQKKIDATVNQPPEVIKRVKEILEES*
Ga0070676_1135741023300005328Miscanthus RhizosphereMRWLVGHFIAEAKKLTDWDGRWFLTGEQLQKKMETTINQPPDVIKRIKEFLEES*
Ga0070689_10030187433300005340Switchgrass RhizosphereMRWLVGHFIAEAKKLTDWHGRWFLTGEQLQKKMETTINQPPDVIKRIKEFLEES*
Ga0066697_1030322823300005540SoilLLDWNGTTYLSGEDLRRKIDATVSQPPDVIQRVKEILAES*
Ga0070695_10160498823300005545Corn, Switchgrass And Miscanthus RhizosphereAEAKKLTDWDGRWFLTGEQLQKKMETTISQPLDVIKRIKEILEES*
Ga0070702_10085524123300005615Corn, Switchgrass And Miscanthus RhizosphereKLLDWDGATYLSGEQLQRKMIVTITQPPEVIKRVKEILAES*
Ga0068862_10043548623300005844Switchgrass RhizosphereAEAKKLTDWDGRWFLTGEQLQKKMETTINQPPDVIKRIKEFLEES*
Ga0075421_10178491223300006845Populus RhizospherePEFVAEAKKQLDWDGNTFLTGEQMRQKIEATVTQPADVIKRIKEVLAEE*
Ga0075431_10118858013300006847Populus RhizosphereESFERMLKDAEFAAEAKKLVDWDGATYLSGEQLQKKMIATVTQPPEVIKRVKEILAE*
Ga0075431_10202169423300006847Populus RhizosphereERMLKDGEFVAEAKKLLDWDGATYLSGEQLQKKMISTITQPPEVIKRIKEILAES*
Ga0075420_10121131223300006853Populus RhizosphereAAPPGVAQERLQILRDSFQRIWQDAEFAAEAKKLTDWDGRWHLTGEQLQKKMETTISQPPDVIKRIKEILEES*
Ga0079215_1005312713300006894Agricultural SoilPEFTADAKKLLDWDGATYLSGEQLQKKMIDTITQPPEVIKRVKEILAES*
Ga0099791_1045894123300007255Vadose Zone SoilEAKKLLDWDGTTYLSGEQLQKKIDATITQPPEVIKRVKEILEES*
Ga0066710_10053832413300009012Grasslands SoilAGVAAEAKKLLEWNGTTYRSGEELRRKIDGTVSQPPDVIERVKEILAEA
Ga0105095_1083207813300009053Freshwater SedimentKKLLDWDGTTFLSGDQLQQKIIATVTQPADVVKRVKEIMAE*
Ga0105106_1117176113300009078Freshwater SedimentAADAKKLLDWDGATSLSGEQLQKKLIDTVTQPPEVLKLVKEILAES*
Ga0105094_1013080323300009153Freshwater SedimentESKKLLEGDGTTFLSGDQLQKKIIATVTQPADVVKQVKEIMAE*
Ga0105241_1211010223300009174Corn RhizosphereMPKERLQILSESFERMLRDAEFAAEAKKLLDWDGATYLSGEQLQRKMIVTITQPPEVIKRVKEILAES*
Ga0105242_1248371113300009176Miscanthus RhizosphereMRWLVGHFIAEAKKLTDWHGRWFLTGEQLQKKMETTINQPPDVIKRIKEILEES*
Ga0105340_104935313300009610SoilERLQILRESFERMLKDAEFAAEAKKLVDWDGATYLSGEQLQKKMIATVTQPPEVIKRVKEILAE*
Ga0105252_1042886923300009678SoilFERMLKDAEFAAEAKKLLDWDGTTYLSGEQLQKKIEATVTQPPDVIKQVKEVLAES*
Ga0126374_1106183523300009792Tropical Forest SoilERLQILRESFERMLKDAEFAAEAKKLLDWDGTTYLSGAQLQKKIDATVTQPTEVIKRVKEILEES*
Ga0126380_1157657513300010043Tropical Forest SoilSFEIMLKDAEFAAEAKKLLDWDRTTYLSGAQLQKKIDATVTQPTEVIKRVKEILEES*
Ga0126384_1210011623300010046Tropical Forest SoilQILRESFERMLKDGEFAAEAKKLLDWDGTTYLSGEQLQKKIEATVTQPPDVTKRVKEILKES*
Ga0126376_1105927413300010359Tropical Forest SoilKERLQILRESFEKMLKDPEFAAEAKKLLDWDGTTYLSGEQLQKKIEATVTQPPDVTKRVKEILEES*
Ga0126372_1144573013300010360Tropical Forest SoilAAEAKKLLDWDGTTYLSGEQLQKKIEATVTQPPDVTKRVKEILEES*
Ga0126379_1068604023300010366Tropical Forest SoilRLQILRESFEKMLKDPEFAAEAKKLLDWDGTTYLSGEQLQKKIEATVTQPPDVTKRVKEILEES*
Ga0126381_10326168213300010376Tropical Forest SoilEFAAEAKKLLDWDGTTYLSGEQLQKKIEATVTQPPDVTKRVKEILEES*
Ga0134127_1022384323300010399Terrestrial SoilAAPPGVAQERLQILRDSFQRIWQDAEFAAEAKKLTDWDGRWYLTGEQLQKKMEIIISQPSDVIKRIKEILEES*
Ga0134127_1265180723300010399Terrestrial SoilMRWLVGHFIAEAKKLTDWDGRWFLTGEQLQKKMETTINQPPDVIKRIQEFLEES*
Ga0134121_1096099623300010401Terrestrial SoilMRWLVGHFIAEAKKLTDWDGRWFLTGEQLQKKMETINQPPDVIKRIKEFLEES*
Ga0134123_1154641423300010403Terrestrial SoilRVQILRNGFESMLKDAEFAAEAKKLLDWDGRTYLSGEQLQKKLIDTVTQPPEIIKRIKEILSES*
Ga0134123_1298953913300010403Terrestrial SoilQGSGVRAEGKEQLDWDGTAFLNGEQLQKKIDVTVTQPPDVIKRIVLEES*
Ga0137453_106350723300012034SoilAEAKKQLDWDGNTFLTGEQMRQKIEATVTQPPDVIKRIKEVLEES*
Ga0137383_1134110413300012199Vadose Zone SoilKDAEFAAEAKKLLDWDGTTFLSGEHLQKKIDATVTQPPEVIKRVKEILEES*
Ga0137363_1013676723300012202Vadose Zone SoilLLDWDGTTYLSGEQLQKKIDATVTQPPDVIKRVKEILEES*
Ga0137465_113584913300012231SoilPGVAQERLQILRDSFQRIWQDAEFAAEAKKLTDWDGRWHLTGEQLQKKMETTISQPPDVIKRIKEILEES*
Ga0137435_107721013300012232SoilAEAKKLTDWDGRWYLSGEQLQKKMEATITQPPDVIKRIREILEES*
Ga0137358_1015387613300012582Vadose Zone SoilDAGFAAEAKKLLDWNGTTYLSGEDLRRKIDATVSQPPDVIRRVQEVLAES*
Ga0137394_1159122713300012922Vadose Zone SoilFERMLKDAGFAAEAKKLLDWNGTTYLSGEDLRRKIDATVSQPPDVIRRVQEVLAES*
Ga0137407_1006485833300012930Vadose Zone SoilLQILRESFERMLKDTEFAAEAKKLLDWDGTTFLSGEQLQKKIDATVSQPPEVIKRVKDILEES*
Ga0075320_101870723300014255Natural And Restored WetlandsLKMLKDSEFSAEARKLLDWDGGSHFSGEQLQKKIDLTMNQPPEVIKRIKEILTEP*
Ga0180068_106045023300014864SoilFSAEAKKLVDWDGAAFLTGEQLQKKIEVTVTQPPDVIKRIKEILEET*
Ga0180087_109689123300014872SoilMLRDGFQKMLKDADFAAEAKKLIDWDGISHLTGEQLQKRIAETVTQPPDMIKRIKQILEE
Ga0180082_116090613300014880SoilKKLLDWDGTTYLSGEQLQKKIEATVTQPPDVIKQVKEILAES*
Ga0180086_100890013300014883SoilKMLKDREFVAEGKNLLDWDGVSHLDGEQLQKKIEATMNQPPDVIKRIREILTES*
Ga0180089_109339913300015254SoilNLLDWDGISHLDGEQLQKKIEATMNQPPDVIKRIREILTEP*
Ga0182034_1148387513300016371SoilEAKKLLDWDGTTYLSGEQLQKKIDATVTQPPDVIRRVKEILEES
Ga0182040_1113183313300016387SoilMPRLQACQRSDYKILRESFERVLKDPEFAAEAKNLLDWDGPTYLSGEQLQKKIDATVTQPPDVIKRVKEILEES
Ga0184604_1002424723300018000Groundwater SedimentMSVWQDPEFAAEAKKLTDWDGRWFLTGEQLQKKMETTINQPPDVIKRIKEFLEESLGS
Ga0184608_1011893023300018028Groundwater SedimentDTEFAGDAKKLLDWDGTTYLSGEQLQKKIDATVTQPPEVIKRVKEILEES
Ga0184638_132613513300018052Groundwater SedimentMLKDPEFGAEAKKQLDWDGATFLSGEDLRKKIEATVTQPPEVIKRVKEVLAES
Ga0184626_1004949833300018053Groundwater SedimentEFAAEAKKLTDWDGRWYLSGEQLQKKFETTITQPPDVIKRIREILAES
Ga0184637_1034349923300018063Groundwater SedimentAEFAAEAKNLLDWDGISHYSGEQLQKKIEATMNQPPDVIKRIKEILAES
Ga0184624_1014640613300018073Groundwater SedimentDTEFAAEAKKLLDWDGTTYLSGEQLQKKIDATVAQPPDVIKRVKEILEES
Ga0184632_1003410013300018075Groundwater SedimentESFERMLKDSDFAAEAKKLLDWDGATYLSGEQLQKKLIATITQPAEVVKRVKEIMAE
Ga0184627_1022480223300018079Groundwater SedimentFERMLKDAEFTAEAKKLLDWDGRTYLTGEQLQKKIIATVTQPPEVIQRVKEILAESG
Ga0190265_1005214853300018422SoilMSVWQDPEFATEAKKLTDWDGRWFLTGKQLQKKMETTINQPPDVIKRIKEFLEES
Ga0190272_1131464313300018429SoilEFAAEAKKLLDWDGTTFMRGDQLQQKIIAVVSQPADVVKRVKEIMAE
Ga0190272_1239732723300018429SoilLKILRESFVRVWRDPEFAAEAKKLTDWDGSWHLTGDQLQKKIDAAINQPLDVIKRIKEILAE
Ga0190275_1001027913300018432SoilLDWDGTTFMSGDQLQKKIIAVVSQPADVVKRVKDIMAE
Ga0190268_1020797223300018466SoilLVDWDGATYLSGEQLQKKLIATVTQPPEVIKRVKEILAE
Ga0190270_1002013663300018469SoilTDWDGRWHLTGEQLQKKMETTISQPPDVIKRIKEILEES
Ga0190271_1284526813300018481SoilAEAKKLLDWDGATYLSGEQLQKKMVVTITQPPEVIKRVKEILAES
Ga0137408_140060513300019789Vadose Zone SoilLQILRESFERMLKDTEFAAEAKKLLDWDGTTFLSGEQLQKKIDATVSQPPEVIKRVKDILEES
Ga0193707_110861723300019881SoilMRWLVGHFIAEAKKLTDWDGRWFLTGEQLQKKMETTINQPPDVIKRIKEFLEES
Ga0193743_101660123300019889SoilMSVWQDPEFAAEAKKLTDWDGHWFLTGEQLQKKMETTINQPPDVIKRIKEFLEES
Ga0193753_1028617913300020034SoilNLLSSWKTLNVCWHDPEFAAEAKKLTDWDGRWFLTGEQLQKKMETTINQPPDVIKRIKEFLEES
Ga0193717_103026213300020060SoilRMLRDAEFAAEAKKLLDWDGATYLSGEQLQKKMIATITQPPDVIKRVKEILAES
Ga0194128_1009293123300020197Freshwater LakeKDAEFVAEAKKQLDWDGGTFLTGEQMRQKLEVTITQPPEVIKRVKEVLAEE
Ga0194121_1056484313300020200Freshwater LakePGLPPERLQILRESLLRVWRDAEFAAEAKKLTDWDGSWHLTGAELQKRHEAALNQPADVVRRIKEILQES
Ga0222622_1083589713300022756Groundwater SedimentKLTDWDGRWFLTGEQLQKKMETTINQPPDVIKRIKEFLEES
Ga0209322_1012488723300025146SoilMLKDPEFAAEAKKLLDWDGMTFLSGEQLQRKFEANVIQPPDVIKRVKEVLEKS
Ga0209320_1008531113300025155SoilPEFAAEAKKQLDWDGATFLSGEDLRRKIEATVNQPPDVIKRVKEVLEES
Ga0209619_1004068443300025159SoilMLKDPEFAAEAKKLLDWDGMTFLSGDQLQKKIEETVTQPPDVIKRVKEVLEES
Ga0209109_1003920553300025160SoilFERMLKDPEFAAEAKKLLDWDGMTFLSGEQLQKRIEATVTQPPDVIKRVKEVLEES
Ga0209642_1005814333300025167SoilLRESFERMLKDPEFAAEAKKLLDWDGMTFLSGEQLQRKFEANVIQPPDVIKRVKEVLEKS
Ga0209642_1026502323300025167SoilLILRNSFESTLHDAKFSEEAKKHFDWDGSYLTGEQLQRKIEQIVTQPPDVIKRVKEILQ
Ga0209519_1054539013300025318SoilKERLQILRESFERMLKDPEFAAEAKKLLDWDGATYLSGEQLQKKIEATVTQPPDVIKRVKEVLEES
Ga0209640_1009746363300025324SoilPEFAAEAKKLLDWDGATYLSGEQLQKKIEATVTQPPDVIKRVKEVLEES
Ga0209640_1022978023300025324SoilAKFSEEAKKHFDWDGSYLSGEKLQRKIDQIVTQPPDVIKRVKEILE
Ga0209751_1041063723300025327SoilMLKAPEFAAEAKKLLDWDGMTFLSGEQLQRKIEATVTQPPDVIKRIKEVLEES
Ga0210108_105916313300025560Natural And Restored WetlandsAKKQLDWDGNTFLTGEQMRQKIEATVTQPPEVIKRVKEVLAEE
Ga0210100_107246113300025780Natural And Restored WetlandsLKDTDFAAEAKKLLDWDGKTYLSGEQLQKKLIDTVTQPPEILKRVKEILDAAE
Ga0207670_1055844823300025936Switchgrass RhizosphereLDWDGATYLSGEQLQRKMIVTITQPPEVIKRVKEILAES
Ga0210000_100961613300027462Arabidopsis Thaliana RhizosphereSFARMLNDPEFAAEAKKLLDWDGKTYLGGEQLQKKLIDTVSQPPEVLKRVKEILDAAE
Ga0209819_1009924323300027722Freshwater SedimentRMLKDTEFAAEAKKLLDWDGTTYLSGEQLQKKIDATVTQPPGIIKRVKEVLEES
Ga0209382_1090858923300027909Populus RhizosphereESFERMLKDTEFAAEAKKLLDWDGTTFLTGEQLQKKLEATVSQPPEVIKRVKEILEES
Ga0209382_1119410423300027909Populus RhizosphereVDWDGATYLSGEQLQKKMIATVTQPPEVIKRVKEILAE
Ga0310890_1168055313300032075SoilEFTAEAKKLLDWDGTTFLSGDQLQKRMIDTVTQPADVVKRVKEIMAE
Ga0307471_10003971613300032180Hardwood Forest SoilKERLQILRESFERVLKDPEFAAEAKKLLDWDGTTYLSGEQLQKKIDATVTQPPDVIKRVKEILEES
Ga0214472_1029573733300033407SoilAGKLLDWDGGSHFSGEQLQKKIETTMNQPPEVIKRIKEILTES
Ga0364925_0256227_496_6513300034147SedimentRDAEFAAEAKKLLDWDGATYLSGEQLQKKMVVTITQPPEVIKRVKEILAES
Ga0364933_129943_1_1413300034150SedimentFAAEAKKLLDWDGTTFMSGDQLQKKIIATVTQPADVVKRVKEIMAE
Ga0364935_0227722_405_6023300034151SedimentERLQILRESFERMLRDAEFAAEAKKLLDWDGATYLSGEQLQKKMVVTITQPPEVIKRVKEILAES


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.