NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096513

Metagenome / Metatranscriptome Family F096513

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096513
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 45 residues
Representative Sequence MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDV
Number of Associated Samples 74
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.33 %
% of genes near scaffold ends (potentially truncated) 25.96 %
% of genes from short scaffolds (< 2000 bps) 78.85 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.462 % of family members)
Environment Ontology (ENVO) Unclassified
(33.654 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.462 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 34.25%    β-sheet: 0.00%    Coil/Unstructured: 65.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00072Response_reg 34.62
PF13180PDZ_2 7.69
PF00441Acyl-CoA_dh_1 7.69
PF13620CarboxypepD_reg 3.85
PF02771Acyl-CoA_dh_N 2.88
PF10459Peptidase_S46 0.96
PF01381HTH_3 0.96
PF02770Acyl-CoA_dh_M 0.96
PF01264Chorismate_synt 0.96
PF13193AMP-binding_C 0.96
PF08281Sigma70_r4_2 0.96
PF04264YceI 0.96
PF13485Peptidase_MA_2 0.96
PF00150Cellulase 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 11.54
COG0082Chorismate synthaseAmino acid transport and metabolism [E] 0.96
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.96
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.96
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.42 %
UnclassifiedrootN/A10.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100667107All Organisms → cellular organisms → Bacteria → Proteobacteria2233Open in IMG/M
3300000956|JGI10216J12902_102856916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1072Open in IMG/M
3300000956|JGI10216J12902_105165139All Organisms → cellular organisms → Bacteria → Proteobacteria1351Open in IMG/M
3300000956|JGI10216J12902_105745906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1704Open in IMG/M
3300001213|JGIcombinedJ13530_103660154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium855Open in IMG/M
3300003320|rootH2_10132834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3598Open in IMG/M
3300003322|rootL2_10023267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1864Open in IMG/M
3300003323|rootH1_10023020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1123Open in IMG/M
3300003323|rootH1_10027013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1835Open in IMG/M
3300003323|rootH1_10057013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1998Open in IMG/M
3300003323|rootH1_10274425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2998Open in IMG/M
3300004463|Ga0063356_100086855All Organisms → cellular organisms → Bacteria → Proteobacteria3333Open in IMG/M
3300005337|Ga0070682_100010793All Organisms → cellular organisms → Bacteria5196Open in IMG/M
3300005337|Ga0070682_100259445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1257Open in IMG/M
3300005337|Ga0070682_100388486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1052Open in IMG/M
3300005345|Ga0070692_10575585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales741Open in IMG/M
3300005367|Ga0070667_101393697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium657Open in IMG/M
3300005539|Ga0068853_102312437Not Available521Open in IMG/M
3300005577|Ga0068857_101471543All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium663Open in IMG/M
3300005617|Ga0068859_100114342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2763Open in IMG/M
3300005719|Ga0068861_102427804Not Available527Open in IMG/M
3300005841|Ga0068863_100157863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2172Open in IMG/M
3300005944|Ga0066788_10013501All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300009093|Ga0105240_10340540All Organisms → cellular organisms → Bacteria → Proteobacteria1704Open in IMG/M
3300009100|Ga0075418_11499287All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → Taphrinomycotina → Taphrinomycotina incertae sedis → Saitoella → Saitoella complicata → Saitoella complicata NRRL Y-17804732Open in IMG/M
3300009448|Ga0114940_10134958All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300009551|Ga0105238_11319805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium748Open in IMG/M
3300009695|Ga0123337_10083347All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300010038|Ga0126315_11216584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium512Open in IMG/M
3300010397|Ga0134124_10796448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium944Open in IMG/M
3300010397|Ga0134124_12177157Not Available594Open in IMG/M
3300012212|Ga0150985_102431583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium507Open in IMG/M
3300012212|Ga0150985_104317865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium728Open in IMG/M
3300012212|Ga0150985_109428134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium766Open in IMG/M
3300012212|Ga0150985_110171497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium634Open in IMG/M
3300012212|Ga0150985_114628543All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium781Open in IMG/M
3300012469|Ga0150984_101111227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium774Open in IMG/M
3300012469|Ga0150984_102203522All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium717Open in IMG/M
3300012469|Ga0150984_104041597All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1307Open in IMG/M
3300012469|Ga0150984_108407003All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300012469|Ga0150984_109269589All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1303Open in IMG/M
3300012469|Ga0150984_111286905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium551Open in IMG/M
3300012469|Ga0150984_112932145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium653Open in IMG/M
3300012891|Ga0157305_10010882All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300012900|Ga0157292_10005380All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes2605Open in IMG/M
3300012900|Ga0157292_10026905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1420Open in IMG/M
3300012929|Ga0137404_10563887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1021Open in IMG/M
3300012930|Ga0137407_10388502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1291Open in IMG/M
3300012943|Ga0164241_10000315All Organisms → cellular organisms → Bacteria → Proteobacteria101885Open in IMG/M
3300012943|Ga0164241_10002595All Organisms → cellular organisms → Bacteria → Proteobacteria19198Open in IMG/M
3300012985|Ga0164308_10025917All Organisms → cellular organisms → Bacteria → Proteobacteria3503Open in IMG/M
3300014325|Ga0163163_11563094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium721Open in IMG/M
3300014969|Ga0157376_10619854All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300015264|Ga0137403_10434117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1190Open in IMG/M
3300018422|Ga0190265_10830792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1047Open in IMG/M
3300018432|Ga0190275_10094766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2629Open in IMG/M
3300018890|Ga0193595_1153644All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium622Open in IMG/M
3300020034|Ga0193753_10303503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium685Open in IMG/M
3300020203|Ga0163148_10527739All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium534Open in IMG/M
3300021181|Ga0210388_10022033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales5170Open in IMG/M
3300021404|Ga0210389_10179598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1647Open in IMG/M
3300021475|Ga0210392_10228207All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1311Open in IMG/M
(restricted) 3300021517|Ga0224723_1039383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1748Open in IMG/M
3300022512|Ga0242676_1052931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium510Open in IMG/M
3300022512|Ga0242676_1056009All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium501Open in IMG/M
3300022561|Ga0212090_10156767All Organisms → cellular organisms → Bacteria → Proteobacteria2025Open in IMG/M
3300022878|Ga0247761_1001107All Organisms → cellular organisms → Bacteria4905Open in IMG/M
3300022894|Ga0247778_1117540All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300022904|Ga0247769_1038016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1326Open in IMG/M
3300022908|Ga0247779_1040847All Organisms → cellular organisms → Bacteria → Proteobacteria1231Open in IMG/M
3300023265|Ga0247780_1102782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium750Open in IMG/M
3300024288|Ga0179589_10507409Not Available560Open in IMG/M
3300025913|Ga0207695_10237784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1723Open in IMG/M
3300025924|Ga0207694_11221327Not Available636Open in IMG/M
3300026088|Ga0207641_10116872All Organisms → cellular organisms → Bacteria → Proteobacteria2374Open in IMG/M
3300026088|Ga0207641_10178028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1946Open in IMG/M
3300026116|Ga0207674_11878316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium565Open in IMG/M
3300026215|Ga0209849_1021046Not Available1102Open in IMG/M
3300028652|Ga0302166_10030172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1090Open in IMG/M
3300028741|Ga0302256_10053251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1036Open in IMG/M
3300028802|Ga0307503_10035531All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Acytosteliaceae → Heterostelium → Heterostelium album → Heterostelium album PN5001791Open in IMG/M
3300029989|Ga0311365_10298647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1391Open in IMG/M
3300030294|Ga0311349_10394043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1310Open in IMG/M
3300030294|Ga0311349_11516941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium622Open in IMG/M
3300031231|Ga0170824_126333425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium706Open in IMG/M
3300031231|Ga0170824_127884410All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium659Open in IMG/M
3300031232|Ga0302323_100288216All Organisms → cellular organisms → Bacteria → Proteobacteria1698Open in IMG/M
3300031232|Ga0302323_101889162Not Available677Open in IMG/M
3300031232|Ga0302323_103475141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium501Open in IMG/M
3300031456|Ga0307513_10133403Not Available2424Open in IMG/M
3300031456|Ga0307513_10240009All Organisms → cellular organisms → Bacteria → Proteobacteria1618Open in IMG/M
3300031616|Ga0307508_10002662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria18732Open in IMG/M
3300031616|Ga0307508_10105721All Organisms → cellular organisms → Bacteria2413Open in IMG/M
3300031616|Ga0307508_10554049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium748Open in IMG/M
3300031726|Ga0302321_101163868Not Available883Open in IMG/M
3300031730|Ga0307516_10010475All Organisms → cellular organisms → Bacteria → Proteobacteria10185Open in IMG/M
3300031902|Ga0302322_100430930All Organisms → cellular organisms → Bacteria1520Open in IMG/M
3300031918|Ga0311367_10231044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1931Open in IMG/M
3300032144|Ga0315910_11437835Not Available538Open in IMG/M
3300032157|Ga0315912_10360832All Organisms → cellular organisms → Bacteria → Proteobacteria1148Open in IMG/M
3300033417|Ga0214471_10015137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales6065Open in IMG/M
3300033475|Ga0310811_10324668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1750Open in IMG/M
3300033475|Ga0310811_10877786All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium816Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.46%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen10.58%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere6.73%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter5.77%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza5.77%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere4.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.88%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.92%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.96%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009448Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek SourceEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009695Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaGEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018890Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020203Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021517 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaGEnvironmentalOpen in IMG/M
3300022512Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022561Borup_combined assemblyEnvironmentalOpen in IMG/M
3300022878Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L111-311C-4EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022904Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6EnvironmentalOpen in IMG/M
3300022908Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5EnvironmentalOpen in IMG/M
3300023169Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300028652Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3EnvironmentalOpen in IMG/M
3300028741Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10066710723300000364SoilMVESGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI*
JGI10216J12902_10285691623300000956SoilMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKNEPKDNFDDLV*
JGI10216J12902_10516513923300000956SoilMVEPGLVTLTKIVGTLLLAMGIIPFLFLLAPGGDRAEPKDNFDDLNN*
JGI10216J12902_10574590643300000956SoilMVEPGLVTLAKIVGTILLAMGVIPFLFLLSPGGDKSEPKENFDDLV*
JGIcombinedJ13530_10366015413300001213WetlandMVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDLV*
rootH2_1013283433300003320Sugarcane Root And Bulk SoilMARAGYRPGAMVEPGLVTLAKIVGTLLLCMGIIPFTFLLAPGDTSEPEPSDTFDGD*
rootL2_1002326733300003322Sugarcane Root And Bulk SoilMVEPGLVTLTKIVGTLLLAMGIIPFMFLLSSGGDKAEPKDNFDDLI*
rootH1_1002302023300003323Sugarcane Root And Bulk SoilMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDV*
rootH1_1002701323300003323Sugarcane Root And Bulk SoilMARAGYRPGAMVEPGIVTLAKIVGTLLLCMGIIPFTFLLSPGDTSEPDPSDTFDGD*
rootH1_1005701323300003323Sugarcane Root And Bulk SoilMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI*
rootH1_1027442523300003323Sugarcane Root And Bulk SoilMVEPGLVTLAKIVGTLLVAMGVIPFLFLLSPGGDKSEPSDNFDDIN*
Ga0063356_10008685523300004463Arabidopsis Thaliana RhizosphereMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLNN*
Ga0070682_10001079313300005337Corn RhizosphereMVEPGIVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ*
Ga0070682_10025944523300005337Corn RhizosphereMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI*
Ga0070682_10038848613300005337Corn RhizosphereYRGDPMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLV*
Ga0070692_1057558523300005345Corn, Switchgrass And Miscanthus RhizosphereMVEPGLITLTKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDI*
Ga0070667_10139369723300005367Switchgrass RhizosphereMVRAMVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKSEPKENFDDL*
Ga0068853_10231243723300005539Corn RhizosphereMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDV*
Ga0068857_10147154313300005577Corn RhizosphereMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLN*
Ga0068859_10011434233300005617Switchgrass RhizosphereMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSSGGDKSEPKDNFDDV*
Ga0068861_10242780413300005719Switchgrass RhizosphereMVEPGLVTLAKIIGTLLGAMAVVPFLFLLAPGDRSEPELKDTFD
Ga0068863_10015786333300005841Switchgrass RhizosphereMVEPGIVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPDVKDTFDGDVQ*
Ga0066788_1001350133300005944SoilMVESGFVTLTKIVGTLLLCMGIIPFLFLLAPGDRTEPEETFDGD*
Ga0105240_1034054033300009093Corn RhizosphereMVEPGLVTLAKIVGTLLLCMGIIPFTFLLSPGDTSEPDPSDTFDGD*
Ga0075418_1149928723300009100Populus RhizosphereMVEAGLLTLAKIVGTLLAAMGIIPLVFLMAPGDSSEPKDTFDEH*
Ga0114940_1013495833300009448GroundwaterMVEPGLVTLAKIVGTLLFAMGVVPFLFLLAPGDRSEPEVKDTFDGDVQ*
Ga0105238_1131980523300009551Corn RhizosphereMVEPGLVTLAKIVGTLLCAMGVIPFLFLLSPGGDKAEPKDNFDDLN*
Ga0123337_1008334713300009695Glacier ValleyMVEPGIVTLVKIVGTLLLAMGIVPFLFLLAPGDRSEPEVKDTFDGDVQ*
Ga0126315_1121658413300010038Serpentine SoilMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKAEPKDNFDDI*
Ga0134124_1079644813300010397Terrestrial SoilMVEPGLVTLAKIVGTLLLAMGIIPFMFLLSKGGDKSEPKDNFDDLI*
Ga0134124_1217715713300010397Terrestrial SoilMVEPGIVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPDVKDTFDGDVQ*
Ga0150985_10243158313300012212Avena Fatua RhizospherePGLVTLAKIVGTLLLSMGIIPFLFLLTPGSDKSEPKDNFDDI*
Ga0150985_10431786513300012212Avena Fatua RhizospherePGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLV*
Ga0150985_10942813413300012212Avena Fatua RhizosphereGIVTLAKIVGTLLFAMSVVPFLFLLAPGDRSEPEVKDTFDGDVQ*
Ga0150985_11017149713300012212Avena Fatua RhizosphereEHGLVTLTKIVGTLLLSMGIIPFLFLLSSGGDKSEPKDNFDDI*
Ga0150985_11462854313300012212Avena Fatua RhizosphereGLVTLTKIVGTLLLAMGIIPFLFLLSSGGDKSEPKDNFDDI*
Ga0150984_10111122713300012469Avena Fatua RhizosphereKIVGTLLLAMGIIPFMFLLSPGGDKSEPKDNFDDI*
Ga0150984_10220352223300012469Avena Fatua RhizospherePGLVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPEVKDTFDGDVQ*
Ga0150984_10404159713300012469Avena Fatua RhizosphereEPGLVTLAKIVGTLLLAMGIIPFLFLLSSGGDRAEPKENFDDV*
Ga0150984_10840700313300012469Avena Fatua RhizospherePGLVTLTKIVGTLLLAMGIIPFMFLLSSGGDKAEPKDNFDDLV*
Ga0150984_10926958913300012469Avena Fatua RhizosphereLAKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDI*
Ga0150984_11128690513300012469Avena Fatua RhizospherePGLVTLAKIVGTLLVAMSVVPFLFLLAPGDRTEPETKDTFDGDVQ*
Ga0150984_11293214513300012469Avena Fatua RhizosphereGIVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPDVKDTFDGDVQ*
Ga0157305_1001088233300012891SoilMVEPGLVTLAKIIGTLLGAMAVVPFLFLLAPGDRSEPELKDTFDGDVQ*
Ga0157292_1000538023300012900SoilMVEPGLVTLAKIVGTLLFAMSVVPFLFLLARGDRTEPDVKDTFDGDVQ*
Ga0157292_1002690523300012900SoilMVEPGIVTLAKIVGTLLCAMSVVAVLFLLAPGDRSEPELKDTFDGDVQ*
Ga0137404_1056388723300012929Vadose Zone SoilMVESGLITLTKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDI*
Ga0137407_1038850213300012930Vadose Zone SoilVESGLITLTKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDI*
Ga0164241_10000315403300012943SoilMVEPGLVTLAKIVGTLLGAMGVIPFLFLLSSGGDKAEPKDNFEDLN*
Ga0164241_10002595133300012943SoilMVEPGLVTLAKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDLV*
Ga0164308_1002591753300012985SoilMVESGLITLTKIVGTILLAMGVIPFMFLLSKGGDKSEPKDNFDDLI*
Ga0163163_1156309423300014325Switchgrass RhizosphereMVEPGLVTLAKIVGTLLLAMGIIPFMFLLSSGGDKSEPKENFDDIN*
Ga0157376_1061985433300014969Miscanthus RhizosphereMVEPGLVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ*
Ga0137403_1043411733300015264Vadose Zone SoilMVEPGLVTLTKIVGTLLLAMGIIPFMFLLSKGGDRS
Ga0190265_1083079223300018422SoilMVEPGLVTLAKIVGTILLAMGIIPFIFMLSAGGDRAEPKENFDDLN
Ga0190275_1009476623300018432SoilMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKNEPKDNFDDLV
Ga0193595_115364413300018890SoilMVEPGLVTLAKIVGTLLLGMGIIPFLFLLSPGGDKSEPK
Ga0193753_1030350323300020034SoilMVESGLVTLTKIVGTLLLAMGIIPFMFLLSKDGDKSEPKDNFDDV
Ga0163148_1052773913300020203Freshwater Microbial MatLVTLAKIVGTLLIAMGIIPFLFLLSPGGDKSEPKDHFEDL
Ga0210388_1002203333300021181SoilMVEPGIVTLAKIVGTLLFCAGVIPFIFLLVPGDRSEPTDTFDGD
Ga0210389_1017959823300021404SoilMVEPGIVTLAKIVGTLLFCMGIIPFTFLLAPGEKSEPDAKDTFDGD
Ga0210392_1022820733300021475SoilAKIVGTLLLCMGIIPFLFLLAPGDRTEPKDTFDGD
(restricted) Ga0224723_103938333300021517Freshwater SedimentMVEPGVVTLTKIVGTLLLAMGIIPFLFLLAPGSDSSEPKDTFDEH
Ga0242676_105293113300022512SoilPGIVTLAKIVGTLLFCAGVIPFIFLLVPGDRSEPTDTFDGD
Ga0242676_105600913300022512SoilGFVTLTKIVGTLLLCMGIIPFLFLLAPGDRTEPKDSFDGD
Ga0212090_1015676733300022561Glacier ValleyMVEPGIVTLVKIVGTLLLAMGIVPFLFLLAPGDRSEPEVKDTFDGDVQ
Ga0247761_100110753300022878Plant LitterMVEPGIVTLAKIVGTLLFAMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ
Ga0247778_111754013300022894Plant LitterMVEPGLVTLAKIIGTLLGAMAVVPFLFLLAPGDRSEPELKDTFDGDVQ
Ga0247769_103801623300022904Plant LitterMVEPGIVTLAKIVGTLLFAMGVVPFLFLLAPGDRSEPEVKDTFDGDVQ
Ga0247779_104084723300022908Plant LitterMVEPGIVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPDVKDTFDGDVQ
Ga0247762_100521243300023169Plant LitterMVEPGLVTLAKIIGTLLFAMGTIPVLFLLAPGDSSEPTDRLDSEHKG
Ga0247780_110278223300023265Plant LitterVTLAKIVGTLLCAMSVVPFLFLLAPGDRSEPELKDTFDGDVQ
Ga0179589_1050740923300024288Vadose Zone SoilMVESGLITLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI
Ga0207695_1023778423300025913Corn RhizosphereMVEPGLVTLAKIVGTLLLCMGIIPFTFLLSPGDTSEPDPSDTFDGD
Ga0207694_1122132723300025924Corn RhizosphereMVEPGLVTLAKIVGTLLCAMGVIPFLFLLSPGGDKAEPKDNFDDLN
Ga0207641_1011687233300026088Switchgrass RhizosphereMVEPGIVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPDVKDTFDGDVQ
Ga0207641_1017802823300026088Switchgrass RhizosphereMVEPGLITLTKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDI
Ga0207674_1187831613300026116Corn RhizosphereMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLN
Ga0209849_102104623300026215SoilMVESGFVTLTKIVGTLLLCMGIIPFLFLLAPGDRTEPEETFDGD
Ga0302166_1003017223300028652FenMVEPGLVTLAKIVGTLLLGMSIVPFLFLLAPGDRTEPDAKDSFDGDV
Ga0302256_1005325113300028741FenAMVEPGLVTLAKIVGTLLLGMSIVPFLFLLAPGDRTEPDAKDSFDGDV
Ga0307503_1003553123300028802SoilMVEHGLVTLTKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDI
Ga0311365_1029864723300029989FenMVEPGLVTLAKIVGTLLLGMSIVPFLFLLAPGDRTVPDPKDTFDGDVL
Ga0311349_1039404333300030294FenVEPGIVTLAKIVGTLLCAMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ
Ga0311349_1151694123300030294FenTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPETKDTFDGDVQ
Ga0170824_12633342513300031231Forest SoilMVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKAEPKDNFDDI
Ga0170824_12788441013300031231Forest SoilGLVTLAKIVGTLLLSMGIIPFVFLLAPGERKEPTDTFDGD
Ga0302323_10028821623300031232FenMVEPGIVTLAKIVGTLLCAMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ
Ga0302323_10188916223300031232FenMVEPGLVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ
Ga0302323_10347514113300031232FenMVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFEDLN
Ga0307513_1013340323300031456EctomycorrhizaMVEPGLVTLAKIVGTLLFAMGVVPFLFLLAPGDRKEPETKDTFDGDVQ
Ga0307513_1024000923300031456EctomycorrhizaMVEPGLVTLAKIVGTLLLAMGIVPFLFLLAPGDRTEPEVKDTFDGDVQ
Ga0307508_10002662153300031616EctomycorrhizaMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKAEPKDNFDDI
Ga0307508_1010572123300031616EctomycorrhizaMVEPGFVTLAKIVGTLLLCMGIIPFLFLLAPGDRSEPNETFDGD
Ga0307508_1055404923300031616EctomycorrhizaMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKAEPK
Ga0302321_10116386823300031726FenMPEPGLVTLVKIVGTLLAAMGVVPFLFLLAPGDRKEPNETFDGDVQ
Ga0307516_1001047523300031730EctomycorrhizaMVESGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDRAEPKDNFDDI
Ga0302322_10043093033300031902FenMPEPGLVTLVKIVGTLLAAMGVAFLFLLAPGDRKEPNETFDGDVQ
Ga0311367_1023104413300031918FenVGTLLLGMSIVPFLFLLAPGDRTEPDAKDSFDGDV
Ga0315910_1143783523300032144SoilMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKTEPKENFDDI
Ga0315912_1036083233300032157SoilMVEPGIVTLAKIVGTLLFAMGVIPFLFLAAPGDRTEPEVKDTFDGDVQ
Ga0214471_1001513743300033417SoilVEAGLLTLAKIVGTLVISIGIVPLLFLLAPGDRGEPDDTFTPGV
Ga0310811_1032466843300033475SoilMVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDIN
Ga0310811_1087778623300033475SoilMVESGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.