Basic Information | |
---|---|
Family ID | F096504 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 37 residues |
Representative Sequence | VREEFGGGVGLSVLSLRLVPWRIQVLSELASEISLVINF |
Number of Associated Samples | 59 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 49.04 % |
% of genes near scaffold ends (potentially truncated) | 95.19 % |
% of genes from short scaffolds (< 2000 bps) | 100.00 % |
Associated GOLD sequencing projects | 59 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.192 % of family members) |
Environment Ontology (ENVO) | Unclassified (96.154 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (96.154 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 95.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068866_113262181 | 3300005718 | Miscanthus Rhizosphere | VREEFGGGAGLSVPTLRLVPWWIQILLELVFEISLVINF* |
Ga0105243_130324381 | 3300009148 | Miscanthus Rhizosphere | VREEFGGGAGLSVLSLRLVPWWIQVLLELAFKISMV |
Ga0182122_10576381 | 3300015267 | Miscanthus Phyllosphere | VSEEFGGSVGLSVLSLRLIPWWIQVLLELAYVISLVINF* |
Ga0182122_10711301 | 3300015267 | Miscanthus Phyllosphere | FGGSVGLLVLSLWLVPWRSQVLLDLASEDSLVINF* |
Ga0182154_10727871 | 3300015268 | Miscanthus Phyllosphere | VRKEFGGGAGLSVLTLYLVPWRIQVLLKLAPEDSLV |
Ga0182113_10630041 | 3300015269 | Miscanthus Phyllosphere | VREEFGGSAGLSVLSLHLVPWRIQVLFELASVISLVINF* |
Ga0182188_10221671 | 3300015274 | Miscanthus Phyllosphere | FGGDPGMSVLSLWLVPWQIQVISELASKISLVTNF* |
Ga0182172_10596921 | 3300015275 | Miscanthus Phyllosphere | RQELGGSIGLSVLSLWLVPWRNQVLHKLASMISLVINF* |
Ga0182128_10428661 | 3300015277 | Miscanthus Phyllosphere | RVREEFGGGAGLLVLSLQLVPWQNQVLFELPSEISLVINF* |
Ga0182174_10280381 | 3300015279 | Miscanthus Phyllosphere | EEFGGSTGLSMLSLRLVPWRNQVLHELASGISLVINF* |
Ga0182174_10471481 | 3300015279 | Miscanthus Phyllosphere | VREEFEGDVGLSVLALWLVPWQIQVLIELASEISLVTNF* |
Ga0182160_10162531 | 3300015281 | Miscanthus Phyllosphere | VREEFGGGVGLSMFSLRLVSWRIQVLLELAFEISL |
Ga0182160_10621251 | 3300015281 | Miscanthus Phyllosphere | VREEFGGDVGLSVLSLWLVPWRIQVLSEVASEISLVINF |
Ga0182124_10294362 | 3300015282 | Miscanthus Phyllosphere | REEFGGSAGLSVLSLQLVPWWIQVLPKLASETSLVIDF* |
Ga0182124_10586851 | 3300015282 | Miscanthus Phyllosphere | FGGSVGLSVLSLWLVPWWIKVLPKLASETSLVTNF* |
Ga0182124_10618571 | 3300015282 | Miscanthus Phyllosphere | RVREEFGGGAGLSVLSLWLVPWWIQVLPELASEISLVINF* |
Ga0182156_10118791 | 3300015283 | Miscanthus Phyllosphere | FGGGAGLLVLILQLVPWWIQVLLELASVDSLVINF* |
Ga0182156_10411671 | 3300015283 | Miscanthus Phyllosphere | VRLRVREEFGGDAGLSVLSLWLVPWQNQVLLELTFDISLVINF* |
Ga0182156_10718531 | 3300015283 | Miscanthus Phyllosphere | VREEFGGDAGLSVLSLRLVPWWIQVLLELASEISLVIN |
Ga0182186_10361051 | 3300015285 | Miscanthus Phyllosphere | VREEFGGGVSLSVLSLRLVPWQIQVLLELASEISLV |
Ga0182186_10513031 | 3300015285 | Miscanthus Phyllosphere | VREEFGGGAVLSVLSLWLVPWWIQVLSELASEISLV |
Ga0182186_10570011 | 3300015285 | Miscanthus Phyllosphere | RVREEFGGSVGLSMLSLRIVPWWNQVLLGLGSKISLVINF* |
Ga0182171_10227371 | 3300015287 | Miscanthus Phyllosphere | EFGGSAGLLVLTLRLVPWQNQVLLQLASEISLVINF* |
Ga0182171_10378501 | 3300015287 | Miscanthus Phyllosphere | VRVEFEGCVGLSVLFLWLIPWRIQVLLELASQISLVIN |
Ga0182171_10659951 | 3300015287 | Miscanthus Phyllosphere | VREEFGGSDGLSVLSLRFVPWWIQVLSELAFEISLVTNF |
Ga0182173_10220971 | 3300015288 | Miscanthus Phyllosphere | YGGGVGLSVLPLWLVPWRIQLLSELASEISLVINF* |
Ga0182138_10642011 | 3300015289 | Miscanthus Phyllosphere | VREEFGGCAGLSVLSLRLVPWRIQVLLELDSEISLVINF |
Ga0182125_10421401 | 3300015291 | Miscanthus Phyllosphere | VREEFVGSTGLSVVSLRLVPWRIQVLPKLASKISLVIN |
Ga0182125_10787121 | 3300015291 | Miscanthus Phyllosphere | EFGGSAGLSLLTLRLVLWRIQVLLELASEDSLVINF* |
Ga0182125_10947551 | 3300015291 | Miscanthus Phyllosphere | VKEEFGGGAGLLVLYLRLVPWRIQVLYELASEISLIINF |
Ga0182141_10417421 | 3300015292 | Miscanthus Phyllosphere | VREEFGGGVGLSVLSLRLVPWRIQVLSELASEISLVINF |
Ga0182126_10776021 | 3300015294 | Miscanthus Phyllosphere | EFVGSVSLSVLSLRLVPWQNQVLPELASEISLVINF* |
Ga0182126_10811801 | 3300015294 | Miscanthus Phyllosphere | RVREEFGGGAGLLVLSLRLVSWRIQVLLELAFEISVVINF* |
Ga0182175_10459681 | 3300015295 | Miscanthus Phyllosphere | GGGVGLSVLSLQLVPWQNQVLLELASNISLVVNF* |
Ga0182157_10759551 | 3300015296 | Miscanthus Phyllosphere | ARDEFGGGASLSVLSLWLVSWRIQVLLELAFEISLFINF* |
Ga0182107_10762072 | 3300015299 | Miscanthus Phyllosphere | VREEFGGGDGMSVLSLWLVPWWIQVLLELASKISLV |
Ga0182143_10517551 | 3300015302 | Miscanthus Phyllosphere | VREEYGGGAGLSVLSLWLVPWRIQVLLELAFEISLVVNF |
Ga0182143_10597592 | 3300015302 | Miscanthus Phyllosphere | VREEFWRSPDLSVLSLWLVPWWNQVLHELASEISLVI |
Ga0182143_10837551 | 3300015302 | Miscanthus Phyllosphere | EEFGGSAGLLVLSLWLVPWRIQVLLELASETSLVIDF* |
Ga0182123_10945261 | 3300015303 | Miscanthus Phyllosphere | YRGSVVLSVLSLRLVPWRIQVLLELAFVISLVINF* |
Ga0182112_10738371 | 3300015304 | Miscanthus Phyllosphere | FGGDAGLLVLSLRLVPWQIQVLLELAFEISLVINF* |
Ga0182158_10302851 | 3300015305 | Miscanthus Phyllosphere | EEFGGRVGLSVFSLWLVVWWIQVLPELAYEISLVINF* |
Ga0182158_10849521 | 3300015305 | Miscanthus Phyllosphere | RVREEFGGGVGLSVLSLWLVPWRIQVLSELASVISLVINF* |
Ga0182144_10571882 | 3300015307 | Miscanthus Phyllosphere | EFGGGVGLSVLTLRLVPWQIQVLLELAFKISLVIKF* |
Ga0182144_10788581 | 3300015307 | Miscanthus Phyllosphere | VREEFGGGAGLSVLSLRLVSWQIQVLLELAFEISLVIN |
Ga0182140_10335241 | 3300015314 | Miscanthus Phyllosphere | VRYKVREEFGGGASLSVLSLWLVPWWIQALLELAFKISLVI |
Ga0182127_11090721 | 3300015321 | Miscanthus Phyllosphere | REEFGGGAGLSVLSLWLVPWWILVLLELAFEISLVINF* |
Ga0182127_11207521 | 3300015321 | Miscanthus Phyllosphere | EFGGGAGLSVLSLWLVPWRIQVLPEFASDISLVINF* |
Ga0182110_10347171 | 3300015322 | Miscanthus Phyllosphere | VREEFGGSVGLLVLSLWLVSWCNQVLIELASEISLVI |
Ga0182110_10347501 | 3300015322 | Miscanthus Phyllosphere | VREEFGGSAGLLVLSLHLVPWCSQVLLELASEISLV |
Ga0182110_10993941 | 3300015322 | Miscanthus Phyllosphere | RVREEFGGSVGLWVLSLRLVPLWIQVLLELASEISLVVNF* |
Ga0182129_10657692 | 3300015323 | Miscanthus Phyllosphere | VREEFGGDAGMSVLSLQLVPYQIKVLFELASEISLVINF* |
Ga0182187_11247441 | 3300015341 | Miscanthus Phyllosphere | FGGGDGLLVLSLRLVPWPIQVLSELASEISLVINFCSK* |
Ga0182187_11734441 | 3300015341 | Miscanthus Phyllosphere | FGGSVSLSVLSLQLVPWQNQALLGLISEISLVINF* |
Ga0182155_11429321 | 3300015343 | Miscanthus Phyllosphere | EFGGSAGLSVLSLWLVPWQNQVLLELASEISLAINF* |
Ga0182189_11324221 | 3300015344 | Miscanthus Phyllosphere | VRDEFGGGVGLSVLSLRLVPWWIQVLLELVFEISLV |
Ga0182111_11120071 | 3300015345 | Miscanthus Phyllosphere | VREEYGGGVGLSVPSLRLVPWWIQVLSELASKISLV |
Ga0182111_12385171 | 3300015345 | Miscanthus Phyllosphere | EFGGGVGLSVLSLWLVPWWIQVLSELASEISLVINF* |
Ga0182177_10418811 | 3300015347 | Miscanthus Phyllosphere | VREEFGEGADLSVLSLRLVPWWNQVLHELASKISLVIVDGS* |
Ga0182177_10521161 | 3300015347 | Miscanthus Phyllosphere | VREEFGGGVGLLVLSIRLVPWWIQVLLELAFEISLVIN |
Ga0182177_11562481 | 3300015347 | Miscanthus Phyllosphere | VREEFGVDADLSVLFLRLVPWRIQVLLELAFKISLVI |
Ga0182177_12072751 | 3300015347 | Miscanthus Phyllosphere | VREEFGGGVGLLVLSLWLVPWWIQVLHEFGFEISR |
Ga0182161_11153921 | 3300015351 | Miscanthus Phyllosphere | VREEFGGGADLSVLSLRLVPWWIKVLLVLAFEISLVI |
Ga0182159_10419511 | 3300015355 | Miscanthus Phyllosphere | MEEFGGSAGLSVLSLWLIPWWIQVLLELASKISLVINF |
Ga0182159_10997241 | 3300015355 | Miscanthus Phyllosphere | VREEFGGGVGLSVHSLQLVPWQIQVLSELASEISL |
Ga0182159_11495001 | 3300015355 | Miscanthus Phyllosphere | VREEFIGGVGLLVLSLRLVPWWIQVLFELASEISLV |
Ga0182159_13322291 | 3300015355 | Miscanthus Phyllosphere | KEFGGGAGLSVLSLRLVPWWIQVLLEFAFEIYLIINFWFK* |
Ga0182203_10854241 | 3300017404 | Miscanthus Phyllosphere | VREEFGGGVGLLVLSLWLVPWWIQVLLELASEISLVINF |
Ga0182203_11047041 | 3300017404 | Miscanthus Phyllosphere | VRQEFGGSVGLSVLSLWLVPWRNQVLPELASEDSLVI |
Ga0182204_11078571 | 3300017409 | Miscanthus Phyllosphere | VKEEFGGSTSLSVLSLWLVPWRNQVLFELASKTSL |
Ga0182207_11231111 | 3300017410 | Miscanthus Phyllosphere | VREEFEGGAGLSVLSLWLVAWWIQVLFEIVSGISLVINF |
Ga0182208_10387992 | 3300017411 | Miscanthus Phyllosphere | EFGGDAGLLVLSLWLVPWRNQVLLELVYEISLVINF |
Ga0182208_11185222 | 3300017411 | Miscanthus Phyllosphere | VREEIGGGVGLLVLSLWLVPWWIQVLSELASEISLVI |
Ga0182222_10303721 | 3300017413 | Miscanthus Phyllosphere | VKEEFGGGVGLSVHSLWLVPWRIQVLSKLAFEISL |
Ga0182222_10545521 | 3300017413 | Miscanthus Phyllosphere | VREEFRGGAGLSVLSLRLVPWWIQVLLELAFEISLV |
Ga0182222_10668932 | 3300017413 | Miscanthus Phyllosphere | MIRNSEKRVREKFGGGAGLSMLSLRFVPWWIQVLLKLAFEI |
Ga0182202_10959901 | 3300017415 | Miscanthus Phyllosphere | VREEFGGSVGLSVLSLRLVPWRNQALLGLVSEISLV |
Ga0182230_10812821 | 3300017417 | Miscanthus Phyllosphere | VEFEGSADLSMLSLWLLPWRIQVLLELASQISLLINF |
Ga0182230_10976271 | 3300017417 | Miscanthus Phyllosphere | EEFGGGAGLSMLSLWLVPWRIQVLSELAFEISLVINF |
Ga0182228_10718132 | 3300017420 | Miscanthus Phyllosphere | RVREEFGGDASLLVPSLWLVPWWIQVLFELAFEISLVINF |
Ga0182228_11292261 | 3300017420 | Miscanthus Phyllosphere | FGGGVGLSVLSLWLVPWWIQVLSELASEISLVINF |
Ga0182219_10466481 | 3300017424 | Miscanthus Phyllosphere | VREEFGGGAGLSVLSLWLVPWRIQVLLELASEISL |
Ga0182219_10724891 | 3300017424 | Miscanthus Phyllosphere | VKEEFGGSTSLSVLSLWLVPWRNQVLFELASKTSLVINF |
Ga0182224_10749281 | 3300017425 | Miscanthus Phyllosphere | VREEYGGGAILSVLSLWLVPWRIQVLPELASEISLV |
Ga0182190_11515241 | 3300017427 | Miscanthus Phyllosphere | VREEFGGGVGLSVLTLWVVPWWIQVLLELAFEISLLID |
Ga0182206_10389001 | 3300017433 | Miscanthus Phyllosphere | VREEFGGGAGLSVLTLRLVPCRIQVLLELASDDSLVIYF |
Ga0182206_10702241 | 3300017433 | Miscanthus Phyllosphere | EFGGDTGLSVLSLRLVPWRIQVLSELASDISLVTNF |
Ga0182206_10724091 | 3300017433 | Miscanthus Phyllosphere | VREEFGESTGLSVLSLRLVPWRNEVLHELASEISMV |
Ga0182209_10724521 | 3300017436 | Miscanthus Phyllosphere | VREEFGGSAGLSVLSLWLIPWQNQVLIELAYDVPL |
Ga0182221_10263321 | 3300017442 | Miscanthus Phyllosphere | FGGGASLSVLSLQLVFWWIQVLSELASEISPIINV |
Ga0182221_10673692 | 3300017442 | Miscanthus Phyllosphere | VREEFGGSVGLSVLSLRLVPWWNQVLLGLASEICLVTNF |
Ga0182221_11572151 | 3300017442 | Miscanthus Phyllosphere | RVREEFGGGAGLSVLSLWLVPWRIQVLFELASEISMVINFWFK |
Ga0182193_10879791 | 3300017443 | Miscanthus Phyllosphere | VREEFGGSVGLSVLSLRLVPWWNQVLLGLASKICLVTNF |
Ga0182193_10986581 | 3300017443 | Miscanthus Phyllosphere | VREEFGGGAGLSVLSIRLVPWRIQVLSELVSEISLVI |
Ga0182193_11282861 | 3300017443 | Miscanthus Phyllosphere | VREEVGGGASLSMLSLWCIPWWIQVLSELTSEISLVI |
Ga0182225_10737752 | 3300017684 | Miscanthus Phyllosphere | FGGDASLSVLSLWLVPWRIQVLIELASRISLVINF |
Ga0182225_10922922 | 3300017684 | Miscanthus Phyllosphere | VREEFGGDVGLSVLSLWLVPWRIQVLSKLASKIFLVI |
Ga0182225_11271231 | 3300017684 | Miscanthus Phyllosphere | VGKEFGGGAGLSVLSLRLVPWRIQVLSELASEISLVINF |
Ga0182227_10987941 | 3300017685 | Miscanthus Phyllosphere | VKEEFGGSVSLSVLSLWLAPCQSQVHLELASRISLV |
Ga0182223_10365891 | 3300017690 | Miscanthus Phyllosphere | VREEFRESVDLSVLSLWLVPWRNQVLLELGSEDSLVIN |
Ga0182223_10564441 | 3300017690 | Miscanthus Phyllosphere | VREEFGGDAGLSVPSLWLVPWQIQVLSELASEISLV |
Ga0182232_10837461 | 3300021060 | Phyllosphere | VREEFGGGAGLSVLSLWLVPWWIQVLSELVSEISLV |
Ga0207704_117287121 | 3300025938 | Miscanthus Rhizosphere | KEFGGGADLSMLSLRLVPWQIQVLSKLASEISLVINF |
Ga0207648_117085331 | 3300026089 | Miscanthus Rhizosphere | VREEFGGGAGLLVLSLWLVPWWIQVLSELASKISLVIN |
⦗Top⦘ |