NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096411

Metagenome / Metatranscriptome Family F096411

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096411
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 60 residues
Representative Sequence CSQGWEARKELESLHLGAQGCHHQYEGASNGVGSKGDLKPKNGFGGFGCLAYKLK
Number of Associated Samples 83
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.01 %
% of genes near scaffold ends (potentially truncated) 93.27 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (88.462 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(73.077 % of family members)
Environment Ontology (ENVO) Unclassified
(94.231 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(57.692 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.66%    β-sheet: 0.00%    Coil/Unstructured: 84.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02992Transposase_21 0.96



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.46 %
UnclassifiedrootN/A11.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005844|Ga0068862_102477539Not Available531Open in IMG/M
3300009973|Ga0105136_106563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum669Open in IMG/M
3300009980|Ga0105135_120162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum584Open in IMG/M
3300009981|Ga0105133_118864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum597Open in IMG/M
3300009994|Ga0105126_1053607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum514Open in IMG/M
3300010371|Ga0134125_12266265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae591Open in IMG/M
3300010399|Ga0134127_12584417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae588Open in IMG/M
3300014968|Ga0157379_10546837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1077Open in IMG/M
3300014968|Ga0157379_12563568All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae510Open in IMG/M
3300015270|Ga0182183_1041215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae657Open in IMG/M
3300015284|Ga0182101_1050577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum636Open in IMG/M
3300015293|Ga0182103_1000182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3346Open in IMG/M
3300015297|Ga0182104_1089679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum561Open in IMG/M
3300015309|Ga0182098_1065148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum639Open in IMG/M
3300015309|Ga0182098_1069230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum626Open in IMG/M
3300015310|Ga0182162_1086752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum585Open in IMG/M
3300015313|Ga0182164_1083353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum611Open in IMG/M
3300015317|Ga0182136_1024378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum933Open in IMG/M
3300015318|Ga0182181_1026197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae829Open in IMG/M
3300015319|Ga0182130_1120196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae529Open in IMG/M
3300015320|Ga0182165_1127956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum533Open in IMG/M
3300015320|Ga0182165_1143967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae507Open in IMG/M
3300015328|Ga0182153_1130181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum536Open in IMG/M
3300015329|Ga0182135_1130084Not Available540Open in IMG/M
3300015331|Ga0182131_1065293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum706Open in IMG/M
3300015332|Ga0182117_1028340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1003Open in IMG/M
3300015334|Ga0182132_1168692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum503Open in IMG/M
3300015337|Ga0182151_1092832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum636Open in IMG/M
3300015338|Ga0182137_1079161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum710Open in IMG/M
3300015338|Ga0182137_1160776Not Available527Open in IMG/M
3300015340|Ga0182133_1115205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae628Open in IMG/M
3300015348|Ga0182115_1251671Not Available562Open in IMG/M
3300015349|Ga0182185_1175569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum644Open in IMG/M
3300015349|Ga0182185_1279513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae510Open in IMG/M
3300015350|Ga0182163_1148813All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum727Open in IMG/M
3300015353|Ga0182179_1212544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum618Open in IMG/M
3300015354|Ga0182167_1124862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae948Open in IMG/M
3300015354|Ga0182167_1158231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum835Open in IMG/M
3300015354|Ga0182167_1167975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum808Open in IMG/M
3300017414|Ga0182195_1168495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae563Open in IMG/M
3300017422|Ga0182201_1051024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum717Open in IMG/M
3300017422|Ga0182201_1120780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum536Open in IMG/M
3300017432|Ga0182196_1058082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum708Open in IMG/M
3300017439|Ga0182200_1160657All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum506Open in IMG/M
3300017693|Ga0182216_1193958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum533Open in IMG/M
3300020031|Ga0182119_104122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum597Open in IMG/M
3300028053|Ga0268346_1034760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae546Open in IMG/M
3300028056|Ga0268330_1009925Not Available932Open in IMG/M
3300028058|Ga0268332_1003051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1368Open in IMG/M
3300028061|Ga0268314_1049925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum518Open in IMG/M
3300028062|Ga0268342_1005041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1016Open in IMG/M
3300028064|Ga0268340_1051407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum610Open in IMG/M
3300028140|Ga0268334_1006288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum725Open in IMG/M
3300028150|Ga0268343_1019508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae509Open in IMG/M
3300028152|Ga0268336_1017858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum598Open in IMG/M
3300028152|Ga0268336_1029088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum514Open in IMG/M
3300028251|Ga0268324_1016635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum580Open in IMG/M
3300028253|Ga0268316_1012249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum625Open in IMG/M
3300028256|Ga0268304_1012925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum536Open in IMG/M
3300028262|Ga0268310_1052762Not Available501Open in IMG/M
3300028529|Ga0268311_1027119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum519Open in IMG/M
3300028529|Ga0268311_1029319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum505Open in IMG/M
3300032465|Ga0214493_1123692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum608Open in IMG/M
3300032466|Ga0214503_1253857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae544Open in IMG/M
3300032467|Ga0214488_1139423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum505Open in IMG/M
3300032469|Ga0214491_1114721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae642Open in IMG/M
3300032490|Ga0214495_1148695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum519Open in IMG/M
3300032502|Ga0214490_1101151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum659Open in IMG/M
3300032502|Ga0214490_1124123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum587Open in IMG/M
3300032514|Ga0214502_1406004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum511Open in IMG/M
3300032550|Ga0321340_1016477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1024Open in IMG/M
3300032550|Ga0321340_1027298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum809Open in IMG/M
3300032551|Ga0321339_1142038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum531Open in IMG/M
3300032591|Ga0214484_1129849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum502Open in IMG/M
3300032592|Ga0214504_1008588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1746Open in IMG/M
3300032625|Ga0214501_1223565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum598Open in IMG/M
3300032689|Ga0214497_1024958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae1254Open in IMG/M
3300032697|Ga0214499_1027708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1558Open in IMG/M
3300032758|Ga0314746_1139574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum543Open in IMG/M
3300032758|Ga0314746_1154864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum508Open in IMG/M
3300032759|Ga0314720_1039764Not Available568Open in IMG/M
3300032789|Ga0314725_1002737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1791Open in IMG/M
3300032789|Ga0314725_1032636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum628Open in IMG/M
3300032812|Ga0314745_1013688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1565Open in IMG/M
3300032812|Ga0314745_1023713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1265Open in IMG/M
3300032844|Ga0314743_1053543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum943Open in IMG/M
3300032889|Ga0314751_1055192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae808Open in IMG/M
3300032890|Ga0314747_1024059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum921Open in IMG/M
3300032970|Ga0314716_117272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae852Open in IMG/M
3300032976|Ga0314752_1029261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1036Open in IMG/M
3300033523|Ga0314768_1060907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1269Open in IMG/M
3300033526|Ga0314761_1007751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1912Open in IMG/M
3300033526|Ga0314761_1029318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1172Open in IMG/M
3300033526|Ga0314761_1130090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum556Open in IMG/M
3300033531|Ga0314756_1092566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum525Open in IMG/M
3300033533|Ga0314770_1191821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae642Open in IMG/M
3300033535|Ga0314759_1197691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum639Open in IMG/M
3300033538|Ga0314755_1025890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1397Open in IMG/M
3300033542|Ga0314769_1217948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum641Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere73.08%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere16.35%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated4.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028140Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028150Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028251Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028253Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028256Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032550Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032592Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032812Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032844Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032890Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032970Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032976Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068862_10247753913300005844Switchgrass RhizosphereELEPLHLGAQGHHHQHEGASNGVGSKGDLKPKNGFGGFGGLAYKLK*
Ga0105136_10656313300009973Switchgrass AssociatedGWEARKELESLHLGAQGCHHQNEGASNGVGSKGDLKPKNGFGGFGDLAT*
Ga0105135_12016213300009980Switchgrass AssociatedGCSQGWEARKELEPPHLGAQGCHHQYEGASNGVGSKGDLKAEYGWGGFGGLAYKWK*
Ga0105135_12701713300009980Switchgrass AssociatedMRRTRRSSQSRVLSSTPSQPEEQKQQHLLCDKKEDQWQGGCSQSKEEGKELELLHLGAQGNHHQHEGTSNGVGSKGHLKPKNDFGGFGGLAYKMK*
Ga0105133_11886423300009981Switchgrass AssociatedCSQGWEVRKELESLHLGAQGYHHQYKGASNGVDSKRDLKPKYGFGGFEGLANKMV*
Ga0105126_105360713300009994Switchgrass AssociatedEEYHLLCDQKEDKWQGGCSQDWEARKELESLRLGAQRCHHQYEGASNGVGSKGDLKSKNDYGGFGGLAT*
Ga0134125_1226626513300010371Terrestrial SoilGGCSKGWEARKELESRHLGAQECHNQYEGTSSGVGSKGDLKPKNGLGEFGGLAKFGMHK*
Ga0134127_1258441713300010399Terrestrial SoilHLLCYHKEGTWQGGWEEGKELEPLHFGVQGHHHQLEGASNSVGSKGDLKPKNDFGGFGGLAT*
Ga0134127_1267508913300010399Terrestrial SoilKSNRTSYVIKKDQWQGGCSEGWEKRKELEPLHLGAQGHHHQYEEVSNGVGFKGDLKPKNDFGGFGGLAHKLK*
Ga0157379_1054683713300014968Switchgrass RhizosphereLCDQKEDQWQGGCSQGWEARKELEPLYLGAQGCHHKLEGASNGVGAKGDLKPKNGYGDFGGLARVGMHE*
Ga0157379_1256356813300014968Switchgrass RhizosphereSKGWEARKELESLHLGAQGCHNQYEGASNGMGSKGDLKPKNGFGGFGGLAN*
Ga0182183_104121513300015270Switchgrass PhyllosphereDCSQDGEARKELESLHLGAQRNHHQYEGTSNGVCSKGDLKPKNGFGGFGGLANKKMR*
Ga0182101_105057713300015284Switchgrass PhyllosphereERKELESLHLGAQGCHHQYEGASNGVGTKGDLKPKNGFRGFGGLAYKLK*
Ga0182103_100018213300015293Switchgrass PhyllosphereWEEGKELEPLHLGAQGHHHQYEGASNGAGSKGDLKPKNGFGGFGGLVYKLK*
Ga0182104_108967913300015297Switchgrass PhyllosphereQGWKEGKKLEPPHLGAQGNHHQYEGASNGVDSNGDLTPKNGFGGFGGLAYKLK*
Ga0182098_106514813300015309Switchgrass PhyllosphereEEQWQGGWQGGCSQGWEEGLELEPLHLGAQRSHYQHERASNSVGSKGDLKPKNGFGGFGSLAN*
Ga0182098_106923013300015309Switchgrass PhyllosphereKEDQWQGGCSQGWEEGKELEPLHLGAQGHHHQYEGASNGVGSKGDLKPKNGNGGFGGLAYKLK*
Ga0182162_108675213300015310Switchgrass PhyllosphereEENQWQGGCSQGWEARKELESLHLGSQKCHNQYEGASNGVGSKGDLKPKNGFGGFG*
Ga0182164_108335313300015313Switchgrass PhyllosphereLCDQEENKWQGGCSQGWEARKELEPSHLGPQGYHHQYKGASNGVGSKGDLKPKNGFGGFGGLAYKLK*
Ga0182136_102437813300015317Switchgrass PhyllosphereQKEDQWQGGCSQGWEEGKELEPLHLGAQGHHHQYEGASNSVGSKGDLKPNNGFGGFGGLAYKLK*
Ga0182181_102619713300015318Switchgrass PhyllosphereHLLCDQKEDQWQGGCSQGWEEGKELEPLHLGVQGHHHQYEGVSNGVGFKGNLKPKNG*
Ga0182130_112019613300015319Switchgrass PhyllosphereQSWEARKKLESLYLGAQGFHHQYKGVSNGVGFKGDLKPKNDYRRFGGLAYKLK*
Ga0182165_112795613300015320Switchgrass PhyllosphereQGWEARKELESLHLGAQECHNQYEGASNGVGSKGDLKPKNDYGGFGGLAYKLK*
Ga0182165_114396713300015320Switchgrass PhyllosphereHLLCDKKEDKLQGSCSQGWEEEKELEPLHLGVQGYHHQYEGASNGVGSKGGLKPKNSYGGFVGMANKKV*
Ga0182153_113018113300015328Switchgrass PhyllosphereSQGWEARKELEPPHLGAQGCHHQYEGASNDVGSKGDLKPKNGFGGFEGLAYKLK*
Ga0182135_113008413300015329Switchgrass PhyllosphereGCSQGWEAIKELESLHLGAQRCHYQYEGASNGVGSKGDLKHKNDFGGFGGLAT*
Ga0182131_106529313300015331Switchgrass PhyllosphereLLRDKKEDKWQGGCSQGWEEGKELEPLYLVAQGHHHKYEGASNGVGSKGDLKPKNGYGGFGGLAYKLK*
Ga0182117_102834013300015332Switchgrass PhyllosphereEENKWQGGCSQGWEARKELEPSHLGAQGCHHQLEGASNGVGSKGDLKPKNGHGEFGGLAKFGMHK*
Ga0182132_116869213300015334Switchgrass PhyllosphereCDQKENQWQGGCSQGWKVRKELESLHLGAQVCHHQYKGASNSVGSKGDLKLKNGFGGFGDLANKKMR*
Ga0182151_109283213300015337Switchgrass PhyllosphereENKWQGGCSQGWEARKELEPSHLGAQGRHHQYEGASNGVSSKGDLKSKNGFGEFGGLARFGMHK*
Ga0182137_107916113300015338Switchgrass PhyllosphereENKWQGGCSQGWEARKELEPSHLGAQGCHHQYKGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE*
Ga0182137_111570613300015338Switchgrass PhyllosphereGWEARKKLEPPHLGAQGCHNQYEGASNGVGSKGDLKPKNG*
Ga0182137_116077613300015338Switchgrass PhyllosphereARKELESLHLGAQGCHNQYEGASNGVGSKEDLKPKNGKGGFGGLAT*
Ga0182133_111520513300015340Switchgrass PhyllosphereEKDQWQGGCSQSWEEGKGLESFHFGAQGYHHQYEEASNGVGSKEDLKPKNGFGGFGDLAN
Ga0182115_125167113300015348Switchgrass PhyllosphereHILGNKKEDQWQGGCSKKWEEGKELEPLHLRAQGNHQQYEGASNGVGSKRYLKPKIGFGGFGGLAYKMK*
Ga0182185_117556913300015349Switchgrass PhyllosphereLYDQEENQWQDGCSQGWEARKELESLHLGAQGYHHQYEGASNGVGSKGDLKPKNGFGGFGDLAT*
Ga0182185_127951313300015349Switchgrass PhyllosphereDKKEDQWQDGGSHGWVEGKELEPLHLGDKGHHHQYEGASNGVGSKGYLKPKNDYGGFGGLAYKLK*
Ga0182163_114881313300015350Switchgrass PhyllosphereDQKENQWQGGCSQGWKVRKELESLHLGAQVCHHQYKGASNSVGSKGDLKLKNGFGGFGDLANKKMR*
Ga0182179_121254413300015353Switchgrass PhyllosphereLLCDKKEDQWQGGCSQGWEEGKELEPLHLGAQRHHHQYEGSSNGVGSKENLKPKNGFGGFGGLAYKRMS*
Ga0182167_112486223300015354Switchgrass PhyllosphereMNLELIHLGAKGSHHQHEGASNGVRSKAYLKTKIVFVGFGDLADKMM*
Ga0182167_115823113300015354Switchgrass PhyllosphereGGCSQGWEARKELEPSHLGAQGYHHQYKGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE*
Ga0182167_116797513300015354Switchgrass PhyllosphereQGGCSQGWEDRKELEPLHLGAQGTHHQHEGASNGVGSKGYLKLKIGYG*
Ga0182195_116849513300017414Switchgrass PhyllosphereDQKENKWQGGCSTGWEARKELEQPHLGAKGCHHQYEGASTGVGSKGDLKPKNGFGGFGGLAYKLK
Ga0182201_105102413300017422Switchgrass PhyllosphereKQYHLLCDQKEDQWQGGCSQGWEARKELEPLHLGAQGCHHQYEGASNGVGFKGDLKPKIGFGGFGGLAHKLK
Ga0182201_112078013300017422Switchgrass PhyllosphereQGWEARKELESFYLGAQGCHHQYEGASNSVGSKGDLKPKNGFRGFGGLAHKMMRRFKSKS
Ga0182196_105808213300017432Switchgrass PhyllosphereQEENKWQGGCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0182200_116065713300017439Switchgrass PhyllosphereSQGWEARNELESLHLGAQECHYQYEEASNGVGSKGDLKPKNGFGGFGGLAYKLK
Ga0182216_119395813300017693Switchgrass PhyllosphereCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKSKNGFGEFGGLARFGMHK
Ga0182119_10412213300020031Switchgrass PhyllosphereLCDQKENKWQGGCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKNGLGGFGGLAHKLK
Ga0268346_103476013300028053PhyllosphereSQSWEARKELESLHLGAEGCHHQYEGASNGVDSKGDLKPKIDFGGFGGLAI
Ga0268330_100992523300028056PhyllosphereWEARKELKSLYLGAQGCHHQYEGASNGVGSKGDLKPKNGLGGFGGLAN
Ga0268332_100305113300028058PhyllosphereLHDQEKGKWQGGCSQGWEARKELESLYLGAQGCHHQYEGASNGVGSKGDLKPKNGLGGFGGLAN
Ga0268314_104992513300028061PhyllosphereLCDQEENKWQGGCSQGWEARKELEPSHLGAQGYHHQYKGASNGVGSKGDLKSKIVFGEFGGLAKFGVHE
Ga0268342_100504113300028062PhyllosphereCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0268340_105140713300028064PhyllosphereGCSQGWEEGKKLEPSHLGAQGNHHQYEGASNGVGFKGDLKFKNGFGGFGGLAYKLK
Ga0268334_100628833300028140PhyllosphereSGCSQSWEEGKELEPLHLGAQGHYHQYEGVSNGVGSKGDLKPKNGFGGFGCLAYKLK
Ga0268343_101950813300028150PhyllosphereWEARKELEPSHLGTQGCHHQYEGASNGVGSKGDLKPKIGYGEFGGLAKFGVHE
Ga0268336_101785813300028152PhyllosphereEKGKWQGGCSQDWEARKELESLHLGAQGCHHQYEGASNGVGSKGDLKTKNGFRGFGGLAN
Ga0268336_102908813300028152PhyllosphereSWEGRKELESLYLGAQECHNQYEGASNGVGSKGDLKPKNGFGGFGGLAYKLK
Ga0268324_101663513300028251PhyllosphereRKELESLHLGAQGCHHQYEGASNDMGSKGDLKPKNGFGGFGGLAHKLK
Ga0268316_101224913300028253PhyllosphereSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGYGEFGGLAKFGVHE
Ga0268304_101292513300028256PhyllosphereCSQGWEARKELESLHLGAQGCHHQYEGASNGVGSKGDLKPKNGFGGFGCLAYKLK
Ga0268310_103939913300028262PhyllosphereQKETHNQDFSHLHQAQLEKQEQKHHLCNQEENKWQGGCSQGWEARKELELLHLGAQGCHNHYEGVSNGVGSKGDLKPKNGYGGFGGLVYKLK
Ga0268310_105276213300028262PhyllosphereDQWQGGCSHGWEARKELKPLHLGAQGCHHKLEGASNGVGAKGDLKPKNGYGGFGGLAYKL
Ga0268311_102711913300028529PhyllosphereEEDQWQCGCSQGWEEGKKLEALHLGAQGYHHQYEGASNGVGSKEDLKPKNGFGGFGDLAN
Ga0268311_102931913300028529PhyllosphereSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKNGYGGFGCLAYKLK
Ga0214493_112369213300032465Switchgrass PhyllosphereQGGCSQGWEARKELELLHLGAQGCHHQYEGASNGVGSKRDLKPKNGFGGFGGLAT
Ga0214503_125385713300032466Switchgrass PhyllosphereCSQGWEARKELEPSHLGAQGCHHQYEGISNGVGSKGNLKPKNDFRGFGGLAYKLK
Ga0214488_113942313300032467Switchgrass PhyllosphereNQKENQWQGGCSQGWEARKELESLHLGAQGCHHQYEGASNGVGSKGHLKPKNGFGGFGGLAT
Ga0214491_111472123300032469Switchgrass PhyllosphereGCSQGWEARKELESLHLGAQECHNQYEGASNGVGSKGNLKPKNGFGGFGCLAYKLK
Ga0214495_114869513300032490Switchgrass PhyllosphereKQKHLLCDQEENQWQGGCSQGWEARKELESLHLGSQECDNQYEGASNGVGSKGDLKPKNGLGGFGCLAYKLK
Ga0214490_110115113300032502Switchgrass PhyllosphereDQWQGGCSQGWEEGKELEPLHLGAQGHHHQYEGASNGVGSKGDLNPKNGIGGFGGLAHKL
Ga0214490_112412313300032502Switchgrass PhyllosphereEARKELESLHLGAQGCHHQYEGASNGVGSKGDLKPKYGFGGFGVLAN
Ga0214502_140600413300032514Switchgrass PhyllosphereENKWQGGCSQGWEARKELEPSHLGAQGYHHQYEGASNGVGSKGDLKPKNGIGEFGGLAKFGMHK
Ga0321340_101647713300032550Switchgrass PhyllosphereCSQGWEARKELEPPHLGAQGHHLQHEGASNGVGSKGDLKPKNGFGGFGGLAYKLK
Ga0321340_102729823300032550Switchgrass PhyllosphereQGWEEGKELEPLHLGAQGHHHQYEGASNGVGSKGDLKPKNGIGGFGGLAHKLK
Ga0321339_114203813300032551Switchgrass PhyllosphereQEQKHHLYDKEEEQWQSGCSKGWEERLELEPFHLGAQGNHHQHEGASNGVGSKGDLKPKNGCGGFGCLAYKLK
Ga0214484_112984923300032591Switchgrass PhyllosphereSQGWEARKELEPPHLGAQGCHNQYERASNGVGSKGDLKPKNGLGGFGGLAYKLK
Ga0214504_100858813300032592Switchgrass PhyllosphereQLGIWDAENKWQGGCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0214501_122356513300032625Switchgrass PhyllosphereQWQGGCSQGWEERKELESFHLGAQGNHHQYEGVSNGVGSKRDLKPKNGNGGFGGLAHKLK
Ga0214497_102495823300032689Switchgrass PhyllosphereQSGSSQGWEAKKELESLYLGVQGCHHQYEGASNGVGSKGDLKPKNGLGDLEA
Ga0214499_102770813300032697Switchgrass PhyllosphereEENQWQGGCSQDWEARKELESLYLGAQGCYHQYKGASNGVGSKGDMKPKNGFGGFGGLAT
Ga0314746_113957413300032758Switchgrass PhyllosphereENQWQGGCSQGWEARKELESLHLGSQECDNQYEGASNGVGFKGDLKPKNGLGGFGCLAYKLK
Ga0314746_115486413300032758Switchgrass PhyllosphereHLLCDQEENQWQGGCSQGWEARKELEPLHLGAQGYHHQYEGASNGVGFKGDLKPKNSYGGFGGLAYKLK
Ga0314720_103976413300032759Switchgrass PhyllosphereCSQSWEEGKELEPLHLGAKGYHHQYEGALNGVGFKEDLKPKNGFGGFGCLAYKLKVKVQAKTS
Ga0314725_100273733300032789Switchgrass PhyllosphereCSQGWEARKELELLHLVAQGCHHQYEGASNGVGSKGHLMPKNGFEGFGGLAT
Ga0314725_103263613300032789Switchgrass PhyllosphereQGGCSQGWEARKELESSHLGAQGCHHKYEEASNGVGSKGDMKPMIGFGGFGGLTHKLK
Ga0314748_108947713300032791Switchgrass PhyllosphereQPEEQKQKHLLCDQEENQWQGGCSQGWEARKELEPSHLGAQGCHYQYEGASNGVGSKGDLKPKNGFGGFGGLGYKLK
Ga0314745_101368813300032812Switchgrass PhyllosphereTASPPPAGGCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0314745_102371323300032812Switchgrass PhyllosphereGCSQVWEARKELESLYLGAQKYHNQYEGASNGVGSKGDLKPKIGVGGFGGLTYKLK
Ga0314743_105354313300032844Switchgrass PhyllosphereEENKWQGDCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKNGIGEFGGLAKFGMHK
Ga0314751_105519213300032889Switchgrass PhyllosphereGQGGCSQGWDEGKELETLHLGVQRHHHQYEGASNGVGSKVDLKPKNGFGGFGGLAYKLK
Ga0314747_102405913300032890Switchgrass PhyllosphereSQGWEEGKELEPLHLGAQGHHHQYEGASNGVGSKGDLNPKNGIGGFGGLAHKLK
Ga0314716_11727223300032970Switchgrass PhyllosphereWQGSCSQGWEARKELEPSHLGAQGCHHQYEGISNGVGSKGNLKPKNDFRGFGGLAYKLK
Ga0314752_102926113300032976Switchgrass PhyllosphereHLLCDKKEDQWQGGCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0314768_106090713300033523Switchgrass PhyllospherePPPAGGCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0314761_100775123300033526Switchgrass PhyllosphereVQLGIWDAENKWQGGCSQGWEARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0314761_102931813300033526Switchgrass PhyllosphereEENQWQGGCSQGWEARKELELLHLGAQGCHHQYERASNSVGSKGHLKPKNGFGGFGGLAT
Ga0314761_113009013300033526Switchgrass PhyllosphereGGCSQGWEEGKELEPLHLGVQGYHHQYEGASNGVGSKGDLKPKNGIGGFGGLAHKLK
Ga0314756_109256613300033531Switchgrass PhyllosphereARKELEPSHLGAQGCHHQYEGASNGVGSKGDLKPKIGFGEFGGLAKFGVHE
Ga0314770_119182113300033533Switchgrass PhyllosphereRKELEPSHLGAQGCHHQYEGISNGVGSKGNLKPKNDFRGFGGLAHKLK
Ga0314759_119769113300033535Switchgrass PhyllosphereQEQTQKHHLCDQQEDQWEGGCSQGWEEGKELEPLHLGAQRSHHQYEGALNGVGYKGYLKPKNGFGGFGGLAYKMK
Ga0314755_102589043300033538Switchgrass PhyllosphereGCSQGWEARKELELLHLGAQGCHHQYERASNSVGSKGHLKPKNGFGGFGGLAT
Ga0314769_121794813300033542Switchgrass PhyllosphereLCDQEENKWQDGCSQGWEARKELEPPHLGAQGHHLQHEGASNGVGSKGDLKPKNGFGGFGGLAYKLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.