Basic Information | |
---|---|
Family ID | F096279 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 43 residues |
Representative Sequence | FLKSKLGDKLRLERFDGDGHALFVDDPEKFNRVLEEFLQSLPK |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.05 % |
% of genes from short scaffolds (< 2000 bps) | 86.67 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.714 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 14.08% Coil/Unstructured: 54.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF01541 | GIY-YIG | 8.57 |
PF09933 | DUF2165 | 4.76 |
PF04773 | FecR | 3.81 |
PF08327 | AHSA1 | 3.81 |
PF11645 | PDDEXK_5 | 2.86 |
PF02091 | tRNA-synt_2e | 2.86 |
PF00005 | ABC_tran | 2.86 |
PF12840 | HTH_20 | 2.86 |
PF02687 | FtsX | 1.90 |
PF12704 | MacB_PCD | 1.90 |
PF09932 | DUF2164 | 1.90 |
PF00144 | Beta-lactamase | 1.90 |
PF02525 | Flavodoxin_2 | 1.90 |
PF00561 | Abhydrolase_1 | 0.95 |
PF15902 | Sortilin-Vps10 | 0.95 |
PF02882 | THF_DHG_CYH_C | 0.95 |
PF00009 | GTP_EFTU | 0.95 |
PF12697 | Abhydrolase_6 | 0.95 |
PF07730 | HisKA_3 | 0.95 |
PF02012 | BNR | 0.95 |
PF00069 | Pkinase | 0.95 |
PF00753 | Lactamase_B | 0.95 |
PF12760 | Zn_Tnp_IS1595 | 0.95 |
PF00990 | GGDEF | 0.95 |
PF01061 | ABC2_membrane | 0.95 |
PF09106 | SelB-wing_2 | 0.95 |
PF00589 | Phage_integrase | 0.95 |
PF07238 | PilZ | 0.95 |
PF00135 | COesterase | 0.95 |
PF13305 | TetR_C_33 | 0.95 |
PF13545 | HTH_Crp_2 | 0.95 |
PF01738 | DLH | 0.95 |
PF00174 | Oxidored_molyb | 0.95 |
PF12680 | SnoaL_2 | 0.95 |
PF08281 | Sigma70_r4_2 | 0.95 |
PF00149 | Metallophos | 0.95 |
PF00501 | AMP-binding | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.81 |
COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 2.86 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.90 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.90 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.90 |
COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.95 |
COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.95 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.95 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.95 |
COG3276 | Selenocysteine-specific translation elongation factor SelB | Translation, ribosomal structure and biogenesis [J] | 0.95 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.95 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.95 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.95 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.95 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.29 % |
Unclassified | root | N/A | 5.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10343913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300001546|JGI12659J15293_10029528 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100686906 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300004080|Ga0062385_10737923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. NSP22.2 | 638 | Open in IMG/M |
3300004092|Ga0062389_101832095 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300005434|Ga0070709_11252233 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300005445|Ga0070708_100191730 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300005536|Ga0070697_100369780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1240 | Open in IMG/M |
3300005541|Ga0070733_10056667 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
3300005557|Ga0066704_10704754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 635 | Open in IMG/M |
3300005587|Ga0066654_10150909 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300005921|Ga0070766_10959560 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Natrialbales → Natrialbaceae → Haloterrigena → Haloterrigena turkmenica | 587 | Open in IMG/M |
3300006050|Ga0075028_100247382 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300006175|Ga0070712_101368667 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300006237|Ga0097621_101716709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300009137|Ga0066709_100642971 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300009177|Ga0105248_11257716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 837 | Open in IMG/M |
3300009519|Ga0116108_1117335 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300009643|Ga0116110_1110532 | Not Available | 927 | Open in IMG/M |
3300009644|Ga0116121_1053189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
3300009645|Ga0116106_1276454 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300009698|Ga0116216_10479920 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300010043|Ga0126380_11628146 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300010371|Ga0134125_11043080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 896 | Open in IMG/M |
3300010379|Ga0136449_100727507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1658 | Open in IMG/M |
3300010379|Ga0136449_101064550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
3300010379|Ga0136449_101216275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1185 | Open in IMG/M |
3300012096|Ga0137389_11667015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300012349|Ga0137387_10996379 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300012354|Ga0137366_10403488 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300012362|Ga0137361_10644293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 970 | Open in IMG/M |
3300012929|Ga0137404_10749773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
3300012929|Ga0137404_11857522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 561 | Open in IMG/M |
3300014164|Ga0181532_10124254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1578 | Open in IMG/M |
3300017822|Ga0187802_10098637 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300017938|Ga0187854_10490144 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300017970|Ga0187783_10952142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300018016|Ga0187880_1034140 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
3300018026|Ga0187857_10042214 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
3300018026|Ga0187857_10151660 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300018030|Ga0187869_10053777 | Not Available | 2117 | Open in IMG/M |
3300018035|Ga0187875_10765487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300019888|Ga0193751_1023909 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
3300020061|Ga0193716_1251753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300020579|Ga0210407_10430923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1032 | Open in IMG/M |
3300020581|Ga0210399_11516095 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300021171|Ga0210405_10545913 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300021181|Ga0210388_11345493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300021402|Ga0210385_10511052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 912 | Open in IMG/M |
3300021407|Ga0210383_11466524 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300021407|Ga0210383_11735613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300021420|Ga0210394_11727185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300021433|Ga0210391_11118498 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300021474|Ga0210390_11655970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300021478|Ga0210402_11532278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300021479|Ga0210410_10061343 | All Organisms → cellular organisms → Bacteria | 3285 | Open in IMG/M |
3300021479|Ga0210410_10700737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 894 | Open in IMG/M |
3300022557|Ga0212123_10539983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300022863|Ga0224532_1018005 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300025473|Ga0208190_1080409 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300025905|Ga0207685_10620379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 582 | Open in IMG/M |
3300025906|Ga0207699_11029627 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300025932|Ga0207690_11710788 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300026075|Ga0207708_12022836 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300026548|Ga0209161_10052532 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300027565|Ga0209219_1137897 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300027745|Ga0209908_10104205 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300027889|Ga0209380_10069997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2002 | Open in IMG/M |
3300027895|Ga0209624_10225495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
3300027895|Ga0209624_10560135 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300028020|Ga0265351_1002314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1373 | Open in IMG/M |
3300028047|Ga0209526_10958808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300028566|Ga0302147_10206590 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300028780|Ga0302225_10331982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 719 | Open in IMG/M |
3300028906|Ga0308309_10094966 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
3300029910|Ga0311369_11372236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300029915|Ga0311358_10710139 | Not Available | 737 | Open in IMG/M |
3300029916|Ga0302148_1234034 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300029944|Ga0311352_10423302 | Not Available | 1087 | Open in IMG/M |
3300030042|Ga0302300_1068836 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300030053|Ga0302177_10004695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9481 | Open in IMG/M |
3300030058|Ga0302179_10171914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300030520|Ga0311372_11606985 | Not Available | 792 | Open in IMG/M |
3300030618|Ga0311354_10852523 | Not Available | 854 | Open in IMG/M |
3300030737|Ga0302310_10108538 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300030814|Ga0265741_105761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300031057|Ga0170834_100033505 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300031090|Ga0265760_10222407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300031233|Ga0302307_10022763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3493 | Open in IMG/M |
3300031234|Ga0302325_10377740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2227 | Open in IMG/M |
3300031344|Ga0265316_10065180 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
3300031718|Ga0307474_10124203 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
3300031753|Ga0307477_11038241 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300031754|Ga0307475_10296558 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300031754|Ga0307475_10918886 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300031754|Ga0307475_11310443 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300031759|Ga0316219_1324652 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031823|Ga0307478_10214090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1554 | Open in IMG/M |
3300031833|Ga0310917_11038821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300032160|Ga0311301_10337933 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
3300032160|Ga0311301_10935443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1160 | Open in IMG/M |
3300032668|Ga0316230_1101234 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300032770|Ga0335085_10317698 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300033433|Ga0326726_12167881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300034163|Ga0370515_0161011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 961 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.33% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.48% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.86% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.86% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.90% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.95% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.95% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.95% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022863 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5 | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_103439132 | 3300001356 | Peatlands Soil | KLRLERFDGDGHALFVDDPEKFNHVLEEFIQSLPQ* |
JGI12659J15293_100295281 | 3300001546 | Forest Soil | KLQLERFDGDGHALFVDDPEKFNRVLEDFLQSVR* |
JGIcombinedJ26739_1006869063 | 3300002245 | Forest Soil | FLKSKLGDKLRLERFDGDGHALFVDDPQKFNHVLGEFLQSLPK* |
Ga0062385_107379231 | 3300004080 | Bog Forest Soil | QPTADYLQSKLGDKLRVERFEGDGHALFIDDPEKFNHVLEEFLRSLPK* |
Ga0062389_1018320951 | 3300004092 | Bog Forest Soil | TQQTADYLQSKLGDKLRVERFEGDGHALFVDDPEKFNHVLEEFLRSLPK* |
Ga0070709_112522331 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QPNADFLKAKLGDRVRLEWFDGDDHALFVDDVEKFNRVVADFVQSLSR* |
Ga0070708_1001917304 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DTQQSADFVKAKLGDKVRLERFDGDGHALFVDDPEKFNRVLEEFLQSLSK* |
Ga0070697_1003697801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLLKSKLGEKVRLERFDGAGHALFVDDPEKFNRVLEEFLQSLPK* |
Ga0070733_100566671 | 3300005541 | Surface Soil | QASAEFLKSKLGDNVQLEKFDGDGHALFVDEPEKFNRVLEEFVRSLSK* |
Ga0066704_107047542 | 3300005557 | Soil | DKVRLERFDGDGHALFVDDPEKFNRVLEEFLQSLSK* |
Ga0066654_101509092 | 3300005587 | Soil | QQTSGSSADFLKAKLGDKVRLERFDGDGHALFVDDPEKFNKILEDYVQSLPN* |
Ga0070766_109595601 | 3300005921 | Soil | SADYLKSKLGDKVQLEKFEGDGHALFVDDPEKFNHVLEEFLKTLPK* |
Ga0075028_1002473821 | 3300006050 | Watersheds | YLKSKLADKLHLEKFEGDGHALFVDDPEKFNHVLEDFMKTLPK* |
Ga0070712_1013686672 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TQQTADLLKSRLGDKVRLARFDGDGHALFVDDPEKFNRVLEEFVRSLPQ* |
Ga0097621_1017167091 | 3300006237 | Miscanthus Rhizosphere | ADFLKAKLGEKVRLERFDGAGHALFVDEPEKFNRVLEDFLQSLPQ* |
Ga0066709_1006429714 | 3300009137 | Grasslands Soil | RVRLERFDGDGHALFVDDPEKFNRVLEEFLQSLSK* |
Ga0105248_112577161 | 3300009177 | Switchgrass Rhizosphere | MQATAELLKTKFGDRVRLEKFDGDGHALFVEDPEKFNRVLEEFVQSLPK* |
Ga0116108_11173351 | 3300009519 | Peatland | SKLGDKLRLEKFDGDGHALFVDDPEKFNRVLDEFIKSLPK* |
Ga0116110_11105321 | 3300009643 | Peatland | PSADFLQSKLGDKLRLERFDGDGHALFIDDPEKFNHVLEGFLQTLPK* |
Ga0116121_10531893 | 3300009644 | Peatland | QPESQPTADFLKTKLGDKLRLERFDGDGHALFVDDPDKFNHVLEEFVQSLPK* |
Ga0116106_12764541 | 3300009645 | Peatland | KLGDKLRLELFGGDGHALFVDEPEKFNRVVEDFIQSLPK* |
Ga0116216_104799201 | 3300009698 | Peatlands Soil | TQQTADFLKLKLGDKLRLERFDGDGHALFADDPERFNRVLEEFLKSLPK* |
Ga0126380_116281461 | 3300010043 | Tropical Forest Soil | NKVRLERFGEDGHALFVDDPVKFNRMVDEFVQSLPNQ* |
Ga0134125_110430803 | 3300010371 | Terrestrial Soil | GDKVRLEKFEDAGHALFVDDAERFNRVLDEFAQSVGK* |
Ga0136449_1007275071 | 3300010379 | Peatlands Soil | PSADFLKSKLGERLRLERFDGDGHALFVDEPEKFNRVLEEFVRGLPK* |
Ga0136449_1010645501 | 3300010379 | Peatlands Soil | YLKSKLGDKVQLERFDGDGHALFVDDPEKFNHVLEDFLQTAWSSH* |
Ga0136449_1012162753 | 3300010379 | Peatlands Soil | QASADFLKSKLGDRLRQERFDGDGHALFVDEPEKFNRVLEEFVKGLPK* |
Ga0137389_116670151 | 3300012096 | Vadose Zone Soil | KVRLERFDGDGHALFVDDPEKFNRVLEEFLQRLPK* |
Ga0137387_109963791 | 3300012349 | Vadose Zone Soil | KSKLGDKVQLERFDGDGHALFVDDPEKFNHVLEAFIQGLPK* |
Ga0137366_104034881 | 3300012354 | Vadose Zone Soil | SKLGDRLKIERFEGDGHALFVDDPEKFNRVLDEFVQGLPK* |
Ga0137361_106442932 | 3300012362 | Vadose Zone Soil | TQQSADFVKAKFGDKVRLERFDGDGHALFVDDPDKFNRVLEEFLQNLPK* |
Ga0137404_107497731 | 3300012929 | Vadose Zone Soil | KVRLERFDGDGHALFVDDPEKFNRVLEEFLESLPK* |
Ga0137404_118575221 | 3300012929 | Vadose Zone Soil | FVKAKLGDKVRLQRFDGDGHALFVDDPQKFNRVLEEFLQSLSK* |
Ga0181532_101242542 | 3300014164 | Bog | PTADFLKSKLGDKLRLEKFDGDGHALFVDDAEKFNRVLDEFIKSLPK* |
Ga0187802_100986373 | 3300017822 | Freshwater Sediment | GANLRLELFEGDGHALFVDDPEKFNHVLEDFLKTSWSSH |
Ga0187854_104901442 | 3300017938 | Peatland | QQSADYLKLKLGDKLRLELFGGDGHALFVDEPEKFNRVVEDFIQSLPK |
Ga0187783_109521421 | 3300017970 | Tropical Peatland | SKLADGVRLERFDGDGHALFVDDPEKFNRVVEEFVGSLPK |
Ga0187880_10341401 | 3300018016 | Peatland | ADFLQLKLGDKLRLERFDGDGHALFIDDPEKFNHVLEGFLQTLPK |
Ga0187857_100422143 | 3300018026 | Peatland | DFLQLKLGDKLRLERFDGDGHALFIDDPEKFNHVLEGFLQTLPK |
Ga0187857_101516602 | 3300018026 | Peatland | SQPTADFLKSKLGDKLRLEKFDGDGHALFVDDPEKFNRVLDEFIKSLPK |
Ga0187869_100537771 | 3300018030 | Peatland | SADFLQLKLGDKLRLERFDGDGHALFIDDPEKFNHVLEGFLQTLPK |
Ga0187875_107654872 | 3300018035 | Peatland | PESQQSADYLKLKLGDRLRLELFDGDGHALFVDDPEKFNHILGDFIRSLPQ |
Ga0193751_10239093 | 3300019888 | Soil | SVFLKSKLGDKLRLERFEGDGHALFVDEPEKFNCVLEEFVRSLPQ |
Ga0193716_12517532 | 3300020061 | Soil | FLKSKLGEKVRLESFEGAGHALFVDDAEKFNRVLAEFMQGLPK |
Ga0210407_104309232 | 3300020579 | Soil | PESEPSADYLKSKLGDKLRLERFEGDGHALFVDEPEKFNHVLEDFLQSLPK |
Ga0210399_115160952 | 3300020581 | Soil | PESQQSADYLKSKLGDKLRLERFDGDGHALFVDDPEKFNHVLEDFMKTAAH |
Ga0210405_105459132 | 3300021171 | Soil | MKNSILKAKLGDKVRLERFDEDGHALFVDDPVKFNRMVEEFVQSLPKQ |
Ga0210388_113454932 | 3300021181 | Soil | LKLKLGDKLRLEIFDGDGHALFVDDPVKFNHVVEDFIQSLPR |
Ga0210385_105110521 | 3300021402 | Soil | LKTNLGDKIGLDRFDGDGHALFVDDPDKFNRVLEEFVKGLPK |
Ga0210383_114665242 | 3300021407 | Soil | ADFLKSKLGEKLRLEKFDGDGHALFVDDPDKFNRLLDEFLKSAPQP |
Ga0210383_117356132 | 3300021407 | Soil | RVQLERFDGDGHAVFVDDPEKFNHVLEDFVHGLPK |
Ga0210394_117271851 | 3300021420 | Soil | TADFLKSKLGDKLRLERFDGDGHALFVDDPEKFNGVVEEFIHNLPK |
Ga0210391_111184981 | 3300021433 | Soil | LGDDVRIERFDGDGHALFVDDPEKFNRVLEEFVHDLPK |
Ga0210390_116559701 | 3300021474 | Soil | GDKLRLEKFDGDGHALFVDDPEKFNRVLEGFMQGLPK |
Ga0210402_115322782 | 3300021478 | Soil | ESQPSADYLKSKLGDKLRVERFEGDGHALFVDEPEKFNRVLEDFLQSLPK |
Ga0210410_100613431 | 3300021479 | Soil | DKVRLERFDGDGHALFVDDPEKFNRVVEEFVQSISK |
Ga0210410_107007372 | 3300021479 | Soil | LKSKLGDKLRLERFDGDGHALFVDEPEKFNRVLEEFVKSLPK |
Ga0212123_105399832 | 3300022557 | Iron-Sulfur Acid Spring | QPSADYIKSKLGDKVRLERFDGDGLALFADEPEKFNRVLEEFVQSVAK |
Ga0224532_10180051 | 3300022863 | Soil | LGDKVRLERFDGDGHALFVDDPEKFNRVLGEFLQSLPR |
Ga0208190_10804092 | 3300025473 | Peatland | ADFLKTKLGDKLRLERFDGDGHALFVDDPDKFNHVLEEFVQSLPK |
Ga0207685_106203791 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KVRLERFDGDGHALFVDDPEKFNRVLEEFLQSLSK |
Ga0207699_110296272 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | KLGDRVRLEWFDGDDHALFVDDVEKFNRVVADFVQSLSR |
Ga0207690_117107882 | 3300025932 | Corn Rhizosphere | TAELLKTKFGDRVRLEKFDGDGHALFVEDPEKFNRVLEEFVQSLPK |
Ga0207708_120228362 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | TLGDKARLEKFEDAGHALFVDDAERFNRVVDEFAQSVGN |
Ga0209161_100525321 | 3300026548 | Soil | QSADFVKAKLGDRVRLERFDGDGHALFVDDPEKFNRVLEEFLQSLSK |
Ga0209219_11378971 | 3300027565 | Forest Soil | LKSKLGDKVRFEKFEGDGHALFVDDPEKFNRVLEEFLQGLPK |
Ga0209908_101042052 | 3300027745 | Thawing Permafrost | KLRLERFDGDGHALFVDDPEKFNRVLEEFLQSLPK |
Ga0209380_100699971 | 3300027889 | Soil | GDKIRLERFDGDGHALFVDDAEKFNRLLEEFIHNIPKLFTPK |
Ga0209624_102254951 | 3300027895 | Forest Soil | QSGSQQSADFVKSKLGDKVRLERFDGDGHALFVDDPEKFNRVVEEFVQSISK |
Ga0209624_105601351 | 3300027895 | Forest Soil | ADFLKSKLGEKVRLERFDGDGHALFVDDPEKFNRVLAEFVQGLPK |
Ga0265351_10023143 | 3300028020 | Soil | SQATAVFLKSKLGDKLRLERFDGDGHALFVDDPEKFNGVVEEFIHNLPK |
Ga0209526_109588081 | 3300028047 | Forest Soil | FLKLKLGDKLRLERFDGDGHALFLDDPEKFNHVLEEFLKTLPK |
Ga0302147_102065902 | 3300028566 | Bog | KMKLGDKLRLEIFEGDGHALFVDDPEKFNHVLESFLQTAWSSH |
Ga0302225_103319822 | 3300028780 | Palsa | DYLKLKLGDSVRLERFDGDGHALFVDDPEKFNHVLAEFVHSLPK |
Ga0308309_100949662 | 3300028906 | Soil | SADFVKSKLGDKVRLERFDGDGHALFVDDPEKFNRVVEEFVQSISK |
Ga0311369_113722361 | 3300029910 | Palsa | KLGDNLRLERFDGDGHALFVDDPEKFNHVLEDFLRTAWSSH |
Ga0311358_107101391 | 3300029915 | Bog | PTADFLKSKLGDKVRLERFDGDGHALFVDDPEKFNRVLGEFLQSLPR |
Ga0302148_12340342 | 3300029916 | Bog | KLGDKLRLEIFEGDGHALFVDDPEKFNHVLESFLQTAWSSH |
Ga0311352_104233021 | 3300029944 | Palsa | LKLKLGDSVRLERFDGDGHALFVDDPEKFNHVLAEFVHSLPK |
Ga0302300_10688361 | 3300030042 | Palsa | KLRLEIFEGDGHALFVDDPEKFNHVLESFLQTAWSSH |
Ga0302177_100046951 | 3300030053 | Palsa | GSQGTADFLKSKLGDKLRLEKFEGDGHALFVDDPEKFNRLLEDFVKGLPSE |
Ga0302179_101719142 | 3300030058 | Palsa | FLKSKLGDKLRLEKFEGDGHALFVDDPEKFNRLLEDFVKGLPSE |
Ga0311372_116069851 | 3300030520 | Palsa | LKLGDSVRLERFDGDGHALFVDDPEKFNHVLAEFVHSLPK |
Ga0311354_108525232 | 3300030618 | Palsa | QPSADYLKLKLGDSVRLERFDGDGHALFVDDPEKFNHVLAEFVHSLPK |
Ga0302310_101085381 | 3300030737 | Palsa | ETQQTADYLKMKLGDKLRLEIFEGDGHALFVDDPEKFNHVLESFLQTAWSSH |
Ga0265741_1057612 | 3300030814 | Soil | LGDKIRLERFDGDGHALFVDDPEKFNRVLEEFIHNLPK |
Ga0170834_1000335052 | 3300031057 | Forest Soil | ADYLKLKLADKIRLERFDGDGHALFVDDPEKFNKLLEEFIKGLGK |
Ga0265760_102224071 | 3300031090 | Soil | ADFVKSKLGDKVRLERFDGDGHALFVDDPEKFNRVVEEFVQSISQ |
Ga0302307_100227631 | 3300031233 | Palsa | TADFLKSKLGDKLRLEKFEGDGHALFVDDPEKFNRLLEDFVKGLPSE |
Ga0302325_103777405 | 3300031234 | Palsa | FLKSKLGDKLRLERFDGDGHALFVDDPEKFNRVLEEFLQSLPK |
Ga0265316_100651801 | 3300031344 | Rhizosphere | YQPESQATADFLKSKLGDKLRLERFDGDGHALFVDEPEKFNHVLEEFIKGLPK |
Ga0307474_101242032 | 3300031718 | Hardwood Forest Soil | FLKSKLGDKVRFEKFEGDGHALFVDDPEKFNRMLEEFLQGLPK |
Ga0307477_110382411 | 3300031753 | Hardwood Forest Soil | KSKLGDKLRLERFDGDGHALFIDDPQKFNRAVEGFVQSLAK |
Ga0307475_102965583 | 3300031754 | Hardwood Forest Soil | LLKSKLGDKVRLERFDGDGHALFVDDPEKFDRLLEEFLQSLPK |
Ga0307475_109188861 | 3300031754 | Hardwood Forest Soil | GDKVRLERFDGDGHALFVDDPEKFDRLLEEFLQSLPK |
Ga0307475_113104432 | 3300031754 | Hardwood Forest Soil | ADYIKSKLGDKLRLELFEGDGHALFVDDPQKFNHVLEEFLQGLPK |
Ga0316219_13246522 | 3300031759 | Freshwater | KLGDRLRLERFDGDGHALFVDDPEKFNRVLEGFIQSLPR |
Ga0307478_102140902 | 3300031823 | Hardwood Forest Soil | KLGDKLRLERFDGDGHALFVDDPEKFNNVLEQFIQGLPK |
Ga0310917_110388212 | 3300031833 | Soil | PTMQQSADFVKSKLGDKVRIKRFDGDGHALFVDDPENFNRVLREFLKELPK |
Ga0311301_103379331 | 3300032160 | Peatlands Soil | PSADFLKSKLGERLRLERFDGDGHALFVDEPEKFNRVLEEFVRGLPK |
Ga0311301_109354431 | 3300032160 | Peatlands Soil | RLRQERFDGDGHALFVDEPEKFNRVLEEFVKGLPK |
Ga0316230_11012342 | 3300032668 | Freshwater | PEMQPTADFLKSKLGDKLRLERFDADGHALFVDDPEKFNRVLEEFIQSLPK |
Ga0335085_103176982 | 3300032770 | Soil | LRLERFEGDGHALFVDDPDKFNRVLDEFVKGLPQL |
Ga0326726_121678811 | 3300033433 | Peat Soil | FLKSKLGDKVRLERFDGDGHALFVDDPEKFNRVLEEFLQSLPR |
Ga0370515_0161011_3_128 | 3300034163 | Untreated Peat Soil | KSKLGDRVRLERFEGDGHALFVDDPEKFDRVLEEFVQSLHK |
⦗Top⦘ |