Basic Information | |
---|---|
Family ID | F096237 |
Family Type | Metagenome |
Number of Sequences | 105 |
Average Sequence Length | 47 residues |
Representative Sequence | MMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG |
Number of Associated Samples | 57 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 88.57 % |
% of genes near scaffold ends (potentially truncated) | 27.62 % |
% of genes from short scaffolds (< 2000 bps) | 82.86 % |
Associated GOLD sequencing projects | 52 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.286 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (21.905 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.33% β-sheet: 0.00% Coil/Unstructured: 90.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF09335 | SNARE_assoc | 2.86 |
PF04392 | ABC_sub_bind | 1.90 |
PF04909 | Amidohydro_2 | 1.90 |
PF02550 | AcetylCoA_hydro | 1.90 |
PF01068 | DNA_ligase_A_M | 1.90 |
PF03734 | YkuD | 0.95 |
PF13442 | Cytochrome_CBB3 | 0.95 |
PF14525 | AraC_binding_2 | 0.95 |
PF07883 | Cupin_2 | 0.95 |
PF00753 | Lactamase_B | 0.95 |
PF13683 | rve_3 | 0.95 |
PF06577 | EipA | 0.95 |
PF03992 | ABM | 0.95 |
PF05661 | DUF808 | 0.95 |
PF07045 | DUF1330 | 0.95 |
PF11149 | DUF2924 | 0.95 |
PF16868 | NMT1_3 | 0.95 |
PF01042 | Ribonuc_L-PSP | 0.95 |
PF00571 | CBS | 0.95 |
PF12680 | SnoaL_2 | 0.95 |
PF03795 | YCII | 0.95 |
PF13458 | Peripla_BP_6 | 0.95 |
PF00072 | Response_reg | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.86 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.86 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.86 |
COG0427 | Propionyl CoA:succinate CoA transferase | Energy production and conversion [C] | 1.90 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.90 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.90 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.90 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.95 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
COG2354 | Membrane protein MutK/YedI, may be involved in DNA repair | Replication, recombination and repair [L] | 0.95 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.29 % |
All Organisms | root | All Organisms | 45.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig46942 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
2199352025|deepsgr__Contig_51619 | Not Available | 561 | Open in IMG/M |
2228664022|INPgaii200_c1190338 | Not Available | 809 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_10929648 | Not Available | 707 | Open in IMG/M |
3300000787|JGI11643J11755_11773783 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300000956|JGI10216J12902_101590720 | Not Available | 585 | Open in IMG/M |
3300001431|F14TB_101619095 | Not Available | 1053 | Open in IMG/M |
3300003911|JGI25405J52794_10026366 | Not Available | 1193 | Open in IMG/M |
3300003911|JGI25405J52794_10161751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 512 | Open in IMG/M |
3300004479|Ga0062595_100601078 | Not Available | 857 | Open in IMG/M |
3300005332|Ga0066388_100528555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1812 | Open in IMG/M |
3300005332|Ga0066388_100675740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1643 | Open in IMG/M |
3300005332|Ga0066388_100892643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1468 | Open in IMG/M |
3300005332|Ga0066388_102844473 | Not Available | 884 | Open in IMG/M |
3300005332|Ga0066388_104138238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
3300005332|Ga0066388_105812079 | Not Available | 624 | Open in IMG/M |
3300005332|Ga0066388_108589868 | Not Available | 508 | Open in IMG/M |
3300005332|Ga0066388_108636190 | Not Available | 506 | Open in IMG/M |
3300005456|Ga0070678_100437484 | Not Available | 1143 | Open in IMG/M |
3300005457|Ga0070662_101421600 | Not Available | 598 | Open in IMG/M |
3300005526|Ga0073909_10466243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 606 | Open in IMG/M |
3300005617|Ga0068859_102432097 | Not Available | 577 | Open in IMG/M |
3300005713|Ga0066905_100032703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2974 | Open in IMG/M |
3300005713|Ga0066905_100092617 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300005713|Ga0066905_100113387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1873 | Open in IMG/M |
3300005713|Ga0066905_100220156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
3300005713|Ga0066905_100292960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1274 | Open in IMG/M |
3300005713|Ga0066905_100468931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1039 | Open in IMG/M |
3300005713|Ga0066905_100564707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 957 | Open in IMG/M |
3300005713|Ga0066905_100609162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 925 | Open in IMG/M |
3300005713|Ga0066905_100804899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
3300005713|Ga0066905_101054802 | Not Available | 719 | Open in IMG/M |
3300005713|Ga0066905_101110586 | Not Available | 703 | Open in IMG/M |
3300005713|Ga0066905_101180088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
3300005713|Ga0066905_101518649 | Not Available | 610 | Open in IMG/M |
3300005713|Ga0066905_101708019 | Not Available | 578 | Open in IMG/M |
3300005713|Ga0066905_101755113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
3300005937|Ga0081455_10084739 | Not Available | 2586 | Open in IMG/M |
3300005937|Ga0081455_10095970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2392 | Open in IMG/M |
3300005983|Ga0081540_1005062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9893 | Open in IMG/M |
3300005983|Ga0081540_1040461 | Not Available | 2429 | Open in IMG/M |
3300006049|Ga0075417_10000979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7360 | Open in IMG/M |
3300006049|Ga0075417_10033795 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300006049|Ga0075417_10056684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1706 | Open in IMG/M |
3300006049|Ga0075417_10268835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 821 | Open in IMG/M |
3300006049|Ga0075417_10381410 | Not Available | 695 | Open in IMG/M |
3300006058|Ga0075432_10004247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4878 | Open in IMG/M |
3300006844|Ga0075428_101087804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 845 | Open in IMG/M |
3300006844|Ga0075428_102008943 | Not Available | 599 | Open in IMG/M |
3300006854|Ga0075425_100426000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1528 | Open in IMG/M |
3300006854|Ga0075425_101528219 | Not Available | 753 | Open in IMG/M |
3300006854|Ga0075425_101539288 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300006871|Ga0075434_100605554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1115 | Open in IMG/M |
3300006871|Ga0075434_101137375 | Not Available | 793 | Open in IMG/M |
3300009092|Ga0105250_10511466 | Not Available | 546 | Open in IMG/M |
3300009094|Ga0111539_10253956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2047 | Open in IMG/M |
3300009094|Ga0111539_10833951 | Not Available | 1073 | Open in IMG/M |
3300009094|Ga0111539_11544035 | Not Available | 770 | Open in IMG/M |
3300009101|Ga0105247_10426264 | Not Available | 951 | Open in IMG/M |
3300009162|Ga0075423_10156415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2393 | Open in IMG/M |
3300009162|Ga0075423_10797915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 999 | Open in IMG/M |
3300009545|Ga0105237_10361802 | Not Available | 1455 | Open in IMG/M |
3300010043|Ga0126380_10005745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5282 | Open in IMG/M |
3300010043|Ga0126380_10013827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3703 | Open in IMG/M |
3300010043|Ga0126380_10758077 | Not Available | 788 | Open in IMG/M |
3300010046|Ga0126384_10481467 | Not Available | 1066 | Open in IMG/M |
3300010046|Ga0126384_11733727 | Not Available | 591 | Open in IMG/M |
3300010047|Ga0126382_10066980 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
3300010047|Ga0126382_10171747 | Not Available | 1510 | Open in IMG/M |
3300010047|Ga0126382_10345938 | Not Available | 1137 | Open in IMG/M |
3300010047|Ga0126382_10819627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
3300010359|Ga0126376_10994078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 838 | Open in IMG/M |
3300010359|Ga0126376_12981140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300010362|Ga0126377_11085848 | Not Available | 869 | Open in IMG/M |
3300010362|Ga0126377_12856795 | Not Available | 557 | Open in IMG/M |
3300010375|Ga0105239_10381438 | Not Available | 1594 | Open in IMG/M |
3300010400|Ga0134122_10838144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ponticoccus → Ponticoccus alexandrii | 882 | Open in IMG/M |
3300011003|Ga0138514_100100650 | Not Available | 626 | Open in IMG/M |
3300012480|Ga0157346_1019632 | Not Available | 579 | Open in IMG/M |
3300012515|Ga0157338_1077603 | Not Available | 531 | Open in IMG/M |
3300012948|Ga0126375_10974699 | Not Available | 688 | Open in IMG/M |
3300012960|Ga0164301_11478907 | Not Available | 558 | Open in IMG/M |
3300014968|Ga0157379_10039114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4232 | Open in IMG/M |
3300015371|Ga0132258_10321632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3813 | Open in IMG/M |
3300015372|Ga0132256_100315696 | Not Available | 1650 | Open in IMG/M |
3300015373|Ga0132257_100561558 | Not Available | 1407 | Open in IMG/M |
3300015373|Ga0132257_102892526 | Not Available | 626 | Open in IMG/M |
3300015374|Ga0132255_100436129 | Not Available | 1914 | Open in IMG/M |
3300015374|Ga0132255_102065000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter marinus | 868 | Open in IMG/M |
3300018072|Ga0184635_10342135 | Not Available | 577 | Open in IMG/M |
3300021560|Ga0126371_11732705 | Not Available | 748 | Open in IMG/M |
3300025986|Ga0207658_10779478 | Not Available | 867 | Open in IMG/M |
3300027873|Ga0209814_10001125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9315 | Open in IMG/M |
3300027873|Ga0209814_10025972 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
3300027873|Ga0209814_10094810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1264 | Open in IMG/M |
3300027880|Ga0209481_10583961 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300028379|Ga0268266_11756997 | Not Available | 595 | Open in IMG/M |
3300028589|Ga0247818_11119854 | Not Available | 560 | Open in IMG/M |
3300028814|Ga0307302_10528310 | Not Available | 586 | Open in IMG/M |
3300031538|Ga0310888_10710153 | Not Available | 617 | Open in IMG/M |
3300031847|Ga0310907_10084921 | Not Available | 1328 | Open in IMG/M |
3300031847|Ga0310907_10740285 | Not Available | 546 | Open in IMG/M |
3300031854|Ga0310904_11395592 | Not Available | 510 | Open in IMG/M |
3300032122|Ga0310895_10545451 | Not Available | 588 | Open in IMG/M |
3300032205|Ga0307472_101185446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 728 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 21.90% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 20.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.71% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 5.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.90% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0942.00003300 | 2166559005 | Simulated | MMTSNEEDLLTHEVSDEALEAAGGNAARNFTMAACTYHVGCAG |
deepsgr_00572290 | 2199352025 | Soil | NEEDLLTHEVSDEALEAAGAYEVAANFTLAACTNMWHCAA |
INPgaii200_11903383 | 2228664022 | Soil | MMTFHTTSNEEDFLIHEVSDEALEAAGGNEVAARYTLANCTGLSECPG |
ICChiseqgaiiFebDRAFT_109296482 | 3300000363 | Soil | MITFVTTSNDEDLLIHEVSDEALEAARGQDIGASYTLANCTGLSECPA* |
JGI11643J11755_117737832 | 3300000787 | Soil | MMTFHTTSNEEDFLIHEVSDEALEAAGGNEVAARYTLANCTGLSECPG* |
JGI10216J12902_1015907201 | 3300000956 | Soil | MMTFLAEEDLPACEVSDEALEAAGANEVVRNYTLAACT |
F14TB_1016190952 | 3300001431 | Soil | MITFVTTSNDEDLLIHEVSDEALEAARGQDIGASYPLANCTGLSECPA* |
JGI25405J52794_100263663 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MDRLLDKNIVSNEEDLLTHEVSDEALEAAGAYEVAANFTLAACTNNWYCAA* |
JGI25405J52794_101617512 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MMTFVETSNEEDLLTHEVSDEALEAAGAYEVAANFTLAACTNMWYCAA* |
Ga0062595_1006010782 | 3300004479 | Soil | MMTLIATSNKEEHLLTHEVSDEALEAAGGNEARNYSLATCTYCFGCVPAISN* |
Ga0066388_1005285552 | 3300005332 | Tropical Forest Soil | MMTFIATSNDEDLLTHEVSDESLEAAGGNEARNEARNFTLAACTQDWGCAG* |
Ga0066388_1006757403 | 3300005332 | Tropical Forest Soil | MMTFLATSNEEDLLTHEVSDEALEAAGANEVAANFSLAGCTNMWYCAA* |
Ga0066388_1008926432 | 3300005332 | Tropical Forest Soil | MMTFIATSNEEDLLAHEVSDEALEAAGGNEATNFTMAACTFHIGCAG* |
Ga0066388_1028444733 | 3300005332 | Tropical Forest Soil | MTFLAPSNEEDLLTHEVSDEALERAGGNEEAGNYTLANCTGLSECPG* |
Ga0066388_1041382381 | 3300005332 | Tropical Forest Soil | MMTFIATSNEEDLLTHEVSDEALEAAGGNQAPNFTMAACTFHVGCAG* |
Ga0066388_1058120792 | 3300005332 | Tropical Forest Soil | MITFLAISNEEDLLTHEVSDEALEAAGGNNEVAGNYTLAACTGLSVCPG* |
Ga0066388_1085898681 | 3300005332 | Tropical Forest Soil | MITLLATSNEEDLLTHDVSDEALEAAGGNEVVGNFTLGNCTGLSVCPG* |
Ga0066388_1086361902 | 3300005332 | Tropical Forest Soil | MMTFLATSNEEDLLTHELSDEALERAGGNEVARNYTLANCTGLSECPG* |
Ga0070678_1004374842 | 3300005456 | Miscanthus Rhizosphere | MMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG* |
Ga0070662_1014216002 | 3300005457 | Corn Rhizosphere | MMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACT |
Ga0073909_104662432 | 3300005526 | Surface Soil | MMTFIATSNDEELLTHEVSDEALEAAGGNEARNFTLAACT |
Ga0068859_1024320972 | 3300005617 | Switchgrass Rhizosphere | MMTFIATSNDEELLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG* |
Ga0066905_1000327035 | 3300005713 | Tropical Forest Soil | MMTFLATLSEEDLLTHEVSDEALEAAGGIEAAGNYTLAACTGLSVCPG* |
Ga0066905_1000926172 | 3300005713 | Tropical Forest Soil | MTFLATSNEEDLLTHEVSDEALERAGGNEEAGNYTLANCTGLSECPG* |
Ga0066905_1001133875 | 3300005713 | Tropical Forest Soil | MMTFPAISLEEDLLIREVSDEALEAAGGNDVAENYTLADCTGLSVCPA* |
Ga0066905_1002201562 | 3300005713 | Tropical Forest Soil | MMTFIDTSNEEDLLTHEVSDEALEAAGVYEVAAKFTLAACTNMWYCAA* |
Ga0066905_1002929602 | 3300005713 | Tropical Forest Soil | MMTFIATSNDEDLLTHEVSDESLEAAGGNEARNFTLAACTQDWGCAG* |
Ga0066905_1004689312 | 3300005713 | Tropical Forest Soil | MMTFIVTSNEEDLLTHEVSDEALEAAGANNKVAGNFSLAGCTLQWYCSA* |
Ga0066905_1005647072 | 3300005713 | Tropical Forest Soil | MILFIDTPNEEDFLTHEVSDEALEAAGGNEATNFTMAACTFHVGCAG* |
Ga0066905_1006091621 | 3300005713 | Tropical Forest Soil | MITLLATSNEDDLLTHDVSDEALEAAGGNEVVGNFTLGNCTGLSVCPG* |
Ga0066905_1008048992 | 3300005713 | Tropical Forest Soil | MMTFIATSNEEDLLTHEVSDEALEAAGGNEATNFTMAACTFHVGCAG* |
Ga0066905_1010548021 | 3300005713 | Tropical Forest Soil | TFIDTSNEEDLLTHEVSDEALEAAGAYEVAANFSLAGCTNMWHCAA* |
Ga0066905_1011105861 | 3300005713 | Tropical Forest Soil | MITFLTTSSEEETLTCDVSDEALESAGANGGAANYTLANCTGLSECPG* |
Ga0066905_1011800881 | 3300005713 | Tropical Forest Soil | MMTFLGTSNEEDLLTHEVPDEALERAGGNEVAGNYTLANCTGLSECPG* |
Ga0066905_1015186491 | 3300005713 | Tropical Forest Soil | MMTFIDTSNEEDLLTHEVSDEALEAAGAYEVAAKFTLAACTNMWYCAA* |
Ga0066905_1017080191 | 3300005713 | Tropical Forest Soil | MMTFLYDFLATSNEEDLFTREVSDEVLEAAGANEVAGNFTLAACTNMWYCA |
Ga0066905_1017551131 | 3300005713 | Tropical Forest Soil | MTFIDTSNEEDLLTHEVSDEALEAAGAYEVTANFTLAACTNNWYCAA* |
Ga0081455_100847394 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMTFLVSSNEEDLLIHEVSDEALEAAGANEVAANFTLAACTNMWYCAA* |
Ga0081455_100959703 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMTFIDTSNDEDLLTHEVSDEALEAAGAYEVAANFTLAACTNMWYCAA* |
Ga0081540_10050624 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MMTFIATSNEEELLTHEVSDEALEAAGGNEVTNFTMAACTFHVGCAG* |
Ga0081540_10404613 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MMTFLATSNEEDLLTHEVSDEALEAAGANEVAANFTLAACTNMWYCAA* |
Ga0075417_100009794 | 3300006049 | Populus Rhizosphere | MMTFHTTSNEEDFLIHELSDEALEAAGGNEVAARYTLANCTGLSECPG* |
Ga0075417_100337952 | 3300006049 | Populus Rhizosphere | MMTFLATSNKEDLLIHEVSDEALEAAGGNEVAARYTLANCTGLSECPG* |
Ga0075417_100566844 | 3300006049 | Populus Rhizosphere | MTFIDTSNEEDLLTHEVSDETLEAAGGNEARNFSMSTCTYYFGCAG* |
Ga0075417_102688351 | 3300006049 | Populus Rhizosphere | MMTFIATSKEEDLLTHEVSDEALEAAGGNEARNFTMAACTFHVGCAG* |
Ga0075417_103814103 | 3300006049 | Populus Rhizosphere | MMTFLAVSSEEDLLTHEVSDEALEAAGGGDAAGNYTLAACTGLS |
Ga0075432_100042475 | 3300006058 | Populus Rhizosphere | MMTFPATSREEDLLIREVSDEALEAAGGNDAAGNYTLADCTGLSVCPA* |
Ga0075428_1010878042 | 3300006844 | Populus Rhizosphere | MMTFIATPNKEEDLLTHEVSDEALEAAGGNEARNYSLATCTYCFGCVPAISN* |
Ga0075428_1020089431 | 3300006844 | Populus Rhizosphere | MSTFLATSNEEDLLIHEVSDEALEAASGNEVAARYTLANCTGLSECPG* |
Ga0075425_1004260004 | 3300006854 | Populus Rhizosphere | MTFIDTSNEEDLLTHEVLDETLEAAGGNEARNFSMSTCTYYFGCAG* |
Ga0075425_1015282191 | 3300006854 | Populus Rhizosphere | MMTFLATSNKEDLLIHEVSDEALEAAGGNEVAARYTLANC |
Ga0075425_1015392882 | 3300006854 | Populus Rhizosphere | MTFLATSNKEDLLIHEVSDEALEAAGGNEVAARYTLANCTGLSECPG* |
Ga0075434_1006055541 | 3300006871 | Populus Rhizosphere | EEDLLTHEVSDEALEAAGGNEARNFTMAACTFHVGCAG* |
Ga0075434_1011373752 | 3300006871 | Populus Rhizosphere | MMTSIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG* |
Ga0105250_105114662 | 3300009092 | Switchgrass Rhizosphere | MMTFIATSNDEELLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG* |
Ga0111539_102539562 | 3300009094 | Populus Rhizosphere | MMTFLATSNKEDLLIHEVSDEALEAAGGSEVAARYTLANCTGLSECPG* |
Ga0111539_108339511 | 3300009094 | Populus Rhizosphere | NEEDLLTHEVSDEALEAAGGNEAGNFTMAACTFHVGCAG* |
Ga0111539_115440351 | 3300009094 | Populus Rhizosphere | MMTFLATSNEEDLLTHEVSDEALERAGGNEIAGNYTLANCT |
Ga0105247_104262642 | 3300009101 | Switchgrass Rhizosphere | MVTKMMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG* |
Ga0075423_101564156 | 3300009162 | Populus Rhizosphere | MMTFIATPNKEEDLLTHEVSDEALEAAGGNEARNYSL |
Ga0075423_107979152 | 3300009162 | Populus Rhizosphere | MMTFIATSKEEDLLTHEVSDEALEAAGGNEARKFTMAACTFHVGCAG* |
Ga0105237_103618021 | 3300009545 | Corn Rhizosphere | EMVTIMMTFIATSNDEELLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG* |
Ga0126380_100057457 | 3300010043 | Tropical Forest Soil | MMTFPAISLEEELLIREVSDEALEAAGGNDVAGNYTLADCTGLSVCPA* |
Ga0126380_100138274 | 3300010043 | Tropical Forest Soil | MMTFIETSNEEDLLTHEVSDEALEAAGAYEVAANFTLAACTNMWYCAA* |
Ga0126380_107580772 | 3300010043 | Tropical Forest Soil | VTMMTFIATSNEEDLLTHEVSDEALEAAGGNEATNFTMAACTFHVGCAG* |
Ga0126384_104814671 | 3300010046 | Tropical Forest Soil | MVTMMTFIATSNDEDLLTHEVSDESLEAAGGNEARNFTLAACTQDWGCAG* |
Ga0126384_117337271 | 3300010046 | Tropical Forest Soil | MTFLATSNEEDLLTHEVSDEALERAGGNEVGGNYTLANCTGLSECPG* |
Ga0126382_100669803 | 3300010047 | Tropical Forest Soil | MMTFLGTSNEEGLPTHEVPDEALERAGGNEVAGNYTLANCTGLSECPG* |
Ga0126382_101717471 | 3300010047 | Tropical Forest Soil | MMTFIATSNEEDLLTHEVSDEALEAAGGNEATNFTMAACTFH |
Ga0126382_103459381 | 3300010047 | Tropical Forest Soil | MVTMMTFIATSNEEDLLTHEVSDEALEAAGGNEATNFTMAACTFHVGCAG* |
Ga0126382_108196272 | 3300010047 | Tropical Forest Soil | MVTMMTFIATSNEEDVLIHEVSDEALEAAGGNEATNFTMAACTFHVGCAG* |
Ga0126376_109940782 | 3300010359 | Tropical Forest Soil | MTFIDTSNEEDLLTHEVSDEALEAAGAYEVAAKFTLAACTNMWYCAA* |
Ga0126376_129811401 | 3300010359 | Tropical Forest Soil | MVTMMTFIATSNEEDVLIHEVSDEALEAAGGNEATNFTMAACTFH |
Ga0126377_110858482 | 3300010362 | Tropical Forest Soil | MVTMMTFIVTSNEEDLLTHEVSDEALEAAGANNKVAGNFSLAGCTLQWYCSA* |
Ga0126377_128567951 | 3300010362 | Tropical Forest Soil | MTFLATSNEEDLLTHEVSDEALERAGGNEVAGNYTLANCTGLSECPG* |
Ga0105239_103814384 | 3300010375 | Corn Rhizosphere | MVTKMMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG* |
Ga0134122_108381442 | 3300010400 | Terrestrial Soil | MVTKMMTSIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG* |
Ga0138514_1001006502 | 3300011003 | Soil | MMTFLHTSNEEDLLTHEVSDEALEAAGAYEVAANFTLAACTNMWHCAA* |
Ga0157346_10196322 | 3300012480 | Arabidopsis Rhizosphere | MVTKMMTSIATSNDEDLLTHEVSDEALEAAGGNEARNFTLA |
Ga0157338_10776031 | 3300012515 | Arabidopsis Rhizosphere | MVTKMMTSIAASNDEDLLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG* |
Ga0126375_109746991 | 3300012948 | Tropical Forest Soil | MMTFIETSNEEDLLTHEVSDEALEAAGAYEVAAKFTLAACTNMWYCAA* |
Ga0164301_114789071 | 3300012960 | Soil | MVTKMMTSIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQD* |
Ga0157379_100391145 | 3300014968 | Switchgrass Rhizosphere | FIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG* |
Ga0132258_103216324 | 3300015371 | Arabidopsis Rhizosphere | MVTKMMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAA |
Ga0132256_1003156962 | 3300015372 | Arabidopsis Rhizosphere | MVTKMMTSIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG* |
Ga0132257_1005615582 | 3300015373 | Arabidopsis Rhizosphere | MVTKMMTSIAASNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQ |
Ga0132257_1028925262 | 3300015373 | Arabidopsis Rhizosphere | SNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG* |
Ga0132255_1004361293 | 3300015374 | Arabidopsis Rhizosphere | MVTKMMTSIAASNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG* |
Ga0132255_1020650001 | 3300015374 | Arabidopsis Rhizosphere | MMTSNEEDLLTHEISDEALEAAGGNAARNFTMAACTYHVGCAG* |
Ga0184635_103421351 | 3300018072 | Groundwater Sediment | MMTFIDTSNEEDLLTHEVSDEALEAAGAYEVAANFTLAACTNMWHCAA |
Ga0126371_117327052 | 3300021560 | Tropical Forest Soil | MVTMMTFIPTSNDEDLLTHEVSDESLEAAGRNEARNFTLAACTQDWGCAG |
Ga0207658_107794781 | 3300025986 | Switchgrass Rhizosphere | MVTKIMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG |
Ga0209814_100011254 | 3300027873 | Populus Rhizosphere | MMTFHTTSNEEDFLIHELSDEALEAAGGNEVAARYTLANCTGLSECPG |
Ga0209814_100259723 | 3300027873 | Populus Rhizosphere | MMTFLATSNKEDLLIHEVSDEALEAAGGNEVAARYTLANCTGLSECPG |
Ga0209814_100948101 | 3300027873 | Populus Rhizosphere | MTFIDTSNEEDLLTHEVSDETLEAAGGNEARNFSMSTCTYYFGCAG |
Ga0209481_105839611 | 3300027880 | Populus Rhizosphere | MMTFIATSKEEDLLTHEVSDEALEAAGGNEARNFTMAACTFHVGCAG |
Ga0268266_117569971 | 3300028379 | Switchgrass Rhizosphere | MVTKMMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG |
Ga0247818_111198542 | 3300028589 | Soil | MTFPATSRDEDLLIREVPDEALEAAGGNDVAGSYTLANCTG |
Ga0307302_105283101 | 3300028814 | Soil | AFLATPNEEDLLTHEVSDEALERAGGNEVAGNYTLANCTGLSVCPG |
Ga0310888_107101531 | 3300031538 | Soil | MMTFIATSNDEELLTHEVSDEALEAAGGNEARNFTLAACTHDWGCAG |
Ga0310907_100849212 | 3300031847 | Soil | MVTKMMTSIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG |
Ga0310907_107402851 | 3300031847 | Soil | MMTFIATSNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQ |
Ga0310904_113955921 | 3300031854 | Soil | SNDEDLLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG |
Ga0310895_105454511 | 3300032122 | Soil | IMMTFIATSNDEELLTHEVSDEALEAAGGNEARNFTLAACTQDWGCAG |
Ga0307472_1011854462 | 3300032205 | Hardwood Forest Soil | MMTFIATSNDEELLTHEVSDEALEAAGGNEARNFTL |
⦗Top⦘ |