Metagenome / Metatranscriptome Family F096117

Basic Information
Family ID	F096117
Family Type	Metagenome / Metatranscriptome
Number of Sequences	105
Average Sequence Length	40 residues
Representative Sequence	LVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA
Number of Associated Samples	87
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	5.71 %
% of genes near scaffold ends (potentially truncated)	93.33 %
% of genes from short scaffolds (< 2000 bps)	93.33 %
Associated GOLD sequencing projects	81
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Bacteria (59.048 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.429 % of family members)
Environment Ontology (ENVO)	Unclassified (36.190 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.667 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF11775	CobT_C	9.52
PF02633	Creatininase	6.67
PF07690	MFS_1	6.67
PF01738	DLH	2.86
PF00072	Response_reg	1.90
PF02482	Ribosomal_S30AE	0.95
PF13419	HAD_2	0.95
PF13365	Trypsin_2	0.95
PF00483	NTP_transferase	0.95
PF00441	Acyl-CoA_dh_1	0.95
PF04909	Amidohydro_2	0.95
PF02594	DUF167	0.95
PF00313	CSD	0.95
PF02563	Poly_export	0.95
PF00005	ABC_tran	0.95
PF02743	dCache_1	0.95
PF00211	Guanylate_cyc	0.95
PF01609	DDE_Tnp_1	0.95
PF04542	Sigma70_r2	0.95
PF00571	CBS	0.95
PF08281	Sigma70_r4_2	0.95
PF01925	TauE	0.95

COG ID	Name	Functional Category	% Frequency in 105 Family Scaffolds
COG1402	Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)	Coenzyme transport and metabolism [H]	6.67
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.95
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.95
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.95
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.95
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.95
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.95
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.95
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.95
COG2972	Sensor histidine kinase YesM	Signal transduction mechanisms [T]	0.95
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.95
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.95
COG1872	Uncharacterized conserved protein YggU, UPF0235/DUF167 family	Function unknown [S]	0.95
COG1596	Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold	Cell wall/membrane/envelope biogenesis [M]	0.95
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.95
COG1544	Ribosome-associated translation inhibitor RaiA	Translation, ribosomal structure and biogenesis [J]	0.95
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.95
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	61.90 %
Unclassified	root	N/A	38.10 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	61.90 %
Unclassified	root	N/A	38.10 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.05 %
Unclassified	root	N/A	38.10 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.90 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	44.76 %
Unclassified	root	N/A	38.10 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.90 %
TACK group	clade	All Organisms → cellular organisms → Archaea → TACK group	0.95 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.95 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	36.19 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.90 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %
Thaumarchaeota	phylum	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	0.95 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	13.33 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	6.67 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5.71 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.90 %
Thaumarchaeota incertae sedis	no rank	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis	0.95 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.95 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3.81 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	1.90 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.90 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.90 %
Candidatus Nitrosotalea	genus	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea	0.95 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.95 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.90 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Glaciimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas	0.95 %
unclassified Candidatus Nitrosotalea	no rank	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea	0.95 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Tylenchina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Panagrolaimomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Strongyloidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Strongyloididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Parastrongyloides	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.10 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	13.33 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	1.90 %
Candidatus Nitrosotalea sp. FS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	0.95 %
Glaciimonas immobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	0.95 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	0.95 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.95 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.95 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.95 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.95 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.95 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005437\|Ga0070710_10255373	All Organisms → cellular organisms → Bacteria → Proteobacteria	1128	Open in IMG/M
3300005437\|Ga0070710_11519792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	503	Open in IMG/M
3300005552\|Ga0066701_10764051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	577	Open in IMG/M
3300005602\|Ga0070762_10847687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	620	Open in IMG/M
3300005764\|Ga0066903_102164779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1072	Open in IMG/M
3300006163\|Ga0070715_10404716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	759	Open in IMG/M
3300006804\|Ga0079221_10092969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1463	Open in IMG/M
3300006893\|Ga0073928_10029834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5277	Open in IMG/M
3300009089\|Ga0099828_11878809	Not Available	525	Open in IMG/M
3300009090\|Ga0099827_10584627	Not Available	962	Open in IMG/M
3300009137\|Ga0066709_102099758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	781	Open in IMG/M
3300009137\|Ga0066709_104625023	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	503	Open in IMG/M
3300010043\|Ga0126380_11964477	Not Available	534	Open in IMG/M
3300010046\|Ga0126384_11468477	Not Available	638	Open in IMG/M
3300010049\|Ga0123356_13630940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	534	Open in IMG/M
3300010343\|Ga0074044_10134939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	1655	Open in IMG/M
3300010361\|Ga0126378_12120499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	641	Open in IMG/M
3300010366\|Ga0126379_12942539	Not Available	570	Open in IMG/M
3300010376\|Ga0126381_100995952	All Organisms → cellular organisms → Bacteria	1209	Open in IMG/M
3300010376\|Ga0126381_101925812	Not Available	852	Open in IMG/M
3300010376\|Ga0126381_102062362	Not Available	821	Open in IMG/M
3300010376\|Ga0126381_103607438	Not Available	607	Open in IMG/M
3300010376\|Ga0126381_103936813	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300010396\|Ga0134126_10978208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	948	Open in IMG/M
3300010398\|Ga0126383_13394185	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300010937\|Ga0137776_1796711	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2472	Open in IMG/M
3300012189\|Ga0137388_10483554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1149	Open in IMG/M
3300012189\|Ga0137388_10512700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1114	Open in IMG/M
3300012208\|Ga0137376_10924483	Not Available	749	Open in IMG/M
3300012212\|Ga0150985_111683862	Not Available	614	Open in IMG/M
3300012349\|Ga0137387_10484450	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	898	Open in IMG/M
3300012362\|Ga0137361_10450209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1182	Open in IMG/M
3300012363\|Ga0137390_10947774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	814	Open in IMG/M
3300012948\|Ga0126375_11677113	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300012971\|Ga0126369_10703155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1088	Open in IMG/M
3300012971\|Ga0126369_12657083	All Organisms → cellular organisms → Bacteria → Proteobacteria	585	Open in IMG/M
3300013770\|Ga0120123_1002692	All Organisms → cellular organisms → Bacteria → Proteobacteria	3317	Open in IMG/M
3300014501\|Ga0182024_12414748	Not Available	569	Open in IMG/M
3300015372\|Ga0132256_102917431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	575	Open in IMG/M
3300016270\|Ga0182036_10704019	Not Available	817	Open in IMG/M
3300016294\|Ga0182041_11388396	Not Available	644	Open in IMG/M
3300016387\|Ga0182040_11724021	Not Available	535	Open in IMG/M
3300016404\|Ga0182037_11109402	Not Available	692	Open in IMG/M
3300018062\|Ga0187784_10109993	Not Available	2246	Open in IMG/M
3300018482\|Ga0066669_11593271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	596	Open in IMG/M
3300020583\|Ga0210401_11104023	All Organisms → cellular organisms → Bacteria → Proteobacteria	652	Open in IMG/M
3300021178\|Ga0210408_11124402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis	603	Open in IMG/M
3300021402\|Ga0210385_11277515	Not Available	563	Open in IMG/M
3300021476\|Ga0187846_10481513	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	508	Open in IMG/M
3300021560\|Ga0126371_11389492	Not Available	833	Open in IMG/M
3300021861\|Ga0213853_11063228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	521	Open in IMG/M
3300022508\|Ga0222728_1125671	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300022529\|Ga0242668_1109039	Not Available	571	Open in IMG/M
3300022530\|Ga0242658_1150040	Not Available	600	Open in IMG/M
3300022840\|Ga0224549_1039980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	636	Open in IMG/M
3300025320\|Ga0209171_10217191	All Organisms → cellular organisms → Bacteria	1067	Open in IMG/M
3300025933\|Ga0207706_10779753	All Organisms → cellular organisms → Bacteria → Proteobacteria	813	Open in IMG/M
3300025939\|Ga0207665_11529191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	530	Open in IMG/M
3300025949\|Ga0207667_11465256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	655	Open in IMG/M
3300025960\|Ga0207651_10739140	Not Available	869	Open in IMG/M
3300027783\|Ga0209448_10055707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1329	Open in IMG/M
3300027874\|Ga0209465_10027612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2656	Open in IMG/M
3300027874\|Ga0209465_10085159	Not Available	1542	Open in IMG/M
3300027882\|Ga0209590_11071354	Not Available	500	Open in IMG/M
3300027884\|Ga0209275_10207822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1061	Open in IMG/M
3300030973\|Ga0075395_11372469	Not Available	583	Open in IMG/M
3300031058\|Ga0308189_10009223	All Organisms → cellular organisms → Bacteria	1982	Open in IMG/M
3300031128\|Ga0170823_16013183	All Organisms → cellular organisms → Bacteria → Proteobacteria	770	Open in IMG/M
3300031446\|Ga0170820_14297725	Not Available	1134	Open in IMG/M
3300031545\|Ga0318541_10046211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2219	Open in IMG/M
3300031564\|Ga0318573_10479819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	669	Open in IMG/M
3300031564\|Ga0318573_10712773	Not Available	539	Open in IMG/M
3300031573\|Ga0310915_10631028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	758	Open in IMG/M
3300031573\|Ga0310915_11059290	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300031679\|Ga0318561_10605250	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300031744\|Ga0306918_11573602	Not Available	501	Open in IMG/M
3300031779\|Ga0318566_10060919	Not Available	1810	Open in IMG/M
3300031793\|Ga0318548_10531163	Not Available	574	Open in IMG/M
3300031797\|Ga0318550_10481762	Not Available	599	Open in IMG/M
3300031833\|Ga0310917_10747908	Not Available	661	Open in IMG/M
3300031846\|Ga0318512_10234609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	903	Open in IMG/M
3300031894\|Ga0318522_10076447	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1218	Open in IMG/M
3300031897\|Ga0318520_10179556	All Organisms → cellular organisms → Bacteria → Proteobacteria	1241	Open in IMG/M
3300031912\|Ga0306921_12383248	Not Available	553	Open in IMG/M
3300031942\|Ga0310916_11725064	All Organisms → cellular organisms → Bacteria → Proteobacteria	506	Open in IMG/M
3300031954\|Ga0306926_12412691	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300031954\|Ga0306926_12423880	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300031959\|Ga0318530_10136576	Not Available	991	Open in IMG/M
3300031959\|Ga0318530_10254218	Not Available	724	Open in IMG/M
3300031959\|Ga0318530_10292831	Not Available	672	Open in IMG/M
3300032001\|Ga0306922_12264878	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS	522	Open in IMG/M
3300032039\|Ga0318559_10543791	Not Available	542	Open in IMG/M
3300032042\|Ga0318545_10027912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1835	Open in IMG/M
3300032043\|Ga0318556_10022376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	2846	Open in IMG/M
3300032055\|Ga0318575_10727194	Not Available	502	Open in IMG/M
3300032059\|Ga0318533_10323704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1121	Open in IMG/M
3300032059\|Ga0318533_11217088	Not Available	551	Open in IMG/M
3300032065\|Ga0318513_10111138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1289	Open in IMG/M
3300032065\|Ga0318513_10149926	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	1112	Open in IMG/M
3300032068\|Ga0318553_10419578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	701	Open in IMG/M
3300032076\|Ga0306924_10615590	Not Available	1227	Open in IMG/M
3300032076\|Ga0306924_10747599	All Organisms → cellular organisms → Bacteria	1094	Open in IMG/M
3300032076\|Ga0306924_12281042	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300032805\|Ga0335078_11558557	Not Available	734	Open in IMG/M
3300032828\|Ga0335080_12314135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	514	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	94.29%
Host-Associated	Host-Associated	5.71%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	89.52%
Aquatic	Environmental → Aquatic	4.76%
Plants	Host-Associated → Plants	4.76%
Arthropoda	Host-Associated → Arthropoda	0.95%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	87.62%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.86%
Freshwater	Environmental → Aquatic → Freshwater	1.90%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.90%
Peat	Environmental → Terrestrial → Peat	0.95%
Cave	Environmental → Terrestrial → Cave	0.95%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	74.29%
Loam	Environmental → Terrestrial → Soil → Loam	8.57%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.76%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	2.86%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.86%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.95%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.95%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.95%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.95%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.95%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.95%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	44.76%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.81%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.76%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.81%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.86%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.90%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.95%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.95%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	0.95%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.95%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.95%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.95%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.95%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.95%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	31.43%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	13.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.43%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	8.57%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.81%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.86%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.86%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.90%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.90%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.90%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.90%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.95%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.95%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	0.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.95%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.95%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.95%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.95%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.95%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.95%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.95%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.95%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.95%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.95%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.95%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.95%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.95%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.95%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010937	Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013770	Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022508	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022529	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022530	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022840	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5	Environmental	Open in IMG/M
3300025320	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)	Environmental	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027783	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental	Open in IMG/M
3300030973	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300031894	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032043	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24	Environmental	Open in IMG/M
3300032055	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032065	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F096117

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070710_102553732	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	YQVGLVIPMLVGTCAAAVSVVIALLISPETKGKELVPDLIVA*
Ga0070710_115197921	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	GYAIPMLVGTVAAAVSVVIALSLSPETKGKVLVAELSVA*
Ga0066701_107640512	3300005552	Soil	MLVGTVVAAISVVISLLLSPETKGKVLVAELQVA*
Ga0070762_108476872	3300005602	Soil	MGYAIPMLVGTVAAAVSVVIALSLSPETKGKVLVAELSVA*
Ga0066903_1021647792	3300005764	Tropical Forest Soil	LGFAIPMLVSTVIAAASVVISLLLSPETKGKVLVPDLVVA*
Ga0070715_104047162	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	NYQVGLVIPMLVGTCAAATSVVIALLISPETKGKELMADLVVT*
Ga0079221_100929691	3300006804	Agricultural Soil	PMLVGTVLAAASVVVSLLLSPETKGKVLVAELSVA*
Ga0073928_100298346	3300006893	Iron-Sulfur Acid Spring	VPVVLAFCAEYFQVGLVIPMLVGTVAAAFSVVVALLLSPETKGQELSAELVVA*
Ga0099828_118788091	3300009089	Vadose Zone Soil	AEFYQVGLVTPMLVGTVVAASSVVVALLISPETKGKVLEAELSIA*
Ga0099827_105846271	3300009090	Vadose Zone Soil	MGYGTPMLVATVAAATSVVIALSLSPETKGQELTADLVVAGADD*
Ga0066709_1020997583	3300009137	Grasslands Soil	GYAVPMQVGTVVAAFSVVIALLVSPETKGKELVAELVVA*
Ga0066709_1046250232	3300009137	Grasslands Soil	PMLVGTVAAAVSVVIALSLSPETKGKVLVAELQVA*
Ga0126380_119644771	3300010043	Tropical Forest Soil	PMLVSTVIAATSVVISLLLSPETKGKVLVSDLVVA*
Ga0126384_114684771	3300010046	Tropical Forest Soil	LEHVADRQLLVSTVVAAASVVISLLLSPETKGKVLVSDLVVA*
Ga0123356_136309401	3300010049	Termite Gut	GYVVPMLVGTVAAAISFAIAVLVGPETKGKAMVADVVVA*
Ga0074044_101349392	3300010343	Bog Forest Soil	EYYQVGLVIPMLVGTVAAAVSVVISLLISPETKGKVLVAELQVA*
Ga0126378_121204992	3300010361	Tropical Forest Soil	FHLGLVTPMLVGTVAAATSVVIALLVSPETKGKILEAELSIA*
Ga0126379_129425391	3300010366	Tropical Forest Soil	IPMLVGTVVAAASVVISLLLSPETKGTVLVAELSVA*
Ga0126381_1009959521	3300010376	Tropical Forest Soil	SLGYAIPMLVGTVVAAASVVIALLLSPETKGKALVAELQVA*
Ga0126381_1019258121	3300010376	Tropical Forest Soil	IPMLVGTVVAAVSVVISLLLSPETKGKALLAELSVA*
Ga0126381_1020623621	3300010376	Tropical Forest Soil	PMLVGTVGAAASVVVALLLSPETKGKELTAELVVA*
Ga0126381_1036074381	3300010376	Tropical Forest Soil	LTFCAEYFQVGLVVPMLIATVAAATSVVIALLISPETKGTVLVAELQVARSGTLSGGLT*
Ga0126381_1039368131	3300010376	Tropical Forest Soil	MLVGTVGAAASVVVALLLSPKTKGKELTAELVVA*
Ga0134126_109782082	3300010396	Terrestrial Soil	YAVPMLVGTVVAAFSVVIALLLSPETKGKELVADLVVA*
Ga0126383_133941852	3300010398	Tropical Forest Soil	MLVSTVIAATSVVISLLLSPETKGKVLVSDLVVA*
Ga0137776_17967112	3300010937	Sediment	MLVGTVLGAVSFVCSLFVSPETKGKVLVPDLLLA*
Ga0137388_104835541	3300012189	Vadose Zone Soil	TPMLVGTVAAAVSVVIALSLSPETKGQELSADLVVAGADD*
Ga0137388_105127001	3300012189	Vadose Zone Soil	MRHAPPMLVGPVAPAVSLVLALSPSPETRGQELPADLVVAGADD*
Ga0137376_109244831	3300012208	Vadose Zone Soil	AVNYGLGYGTPMLVGTVAAATSVVIALSLSPETKGQELTADLVVAGADD*
Ga0150985_1116838622	3300012212	Avena Fatua Rhizosphere	MLVGTVAAAISVVIALSLSPETKGKVLVADLSVA*
Ga0137387_104844503	3300012349	Vadose Zone Soil	MLLGTVIAAASVVVALLLSPETKGQELTADLVVA*
Ga0137361_104502093	3300012362	Vadose Zone Soil	FGLGYGTPMLVGTVAAATSVVIALSLSPETKGQELTADLVVAGADD*
Ga0137390_109477741	3300012363	Vadose Zone Soil	PMLVGTVAAAVSVVIALSLSPETKGQELTADLVVAGADD*
Ga0126375_116771132	3300012948	Tropical Forest Soil	MLVSTVIAAASVVISLLLSPETKGKVLVSDLVLA*
Ga0126369_107031551	3300012971	Tropical Forest Soil	MLVGTVVAAVSVVISLLLSPETKGKALLAELSVA*
Ga0126369_126570831	3300012971	Tropical Forest Soil	MLVGTVAAATSVVIALLVSPETKGKVLEAELSIA*
Ga0120123_10026924	3300013770	Permafrost	QMGYGLPMAAGTIVAAVSVVIALLLSPETMGQELTADLVVAGADD*
Ga0182024_124147482	3300014501	Permafrost	YNVSFAVPMLIGTVVAASSVVVALLISPETKGKELVSELLVA*
Ga0132256_1029174311	3300015372	Arabidopsis Rhizosphere	VIPMLVGTCAAATSVVIALLISPETKGKELMADLVVT*
Ga0182036_107040193	3300016270	Soil	GLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0182041_113883963	3300016294	Soil	LTFCAEYFQVGLVVPMLIATVTAATSVVIALLISPETKGTVFVAELQVA
Ga0182040_117240212	3300016387	Soil	FLAEYFQVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA
Ga0182037_111094021	3300016404	Soil	QVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA
Ga0187784_101099935	3300018062	Tropical Peatland	FKVGLVAPMLVGTVGAAASVVISLLLSPETKGKELTAELVVA
Ga0066669_115932711	3300018482	Grasslands Soil	VGYAIPMAVGTVVAAVSVVIALSLSPETKGQELVADLVTV
Ga0210401_111040232	3300020583	Soil	VIPMLVGTVAAAISVVVSLLISPETKGKVLVAELQVA
Ga0210408_111244022	3300021178	Soil	AEYFHAGLVIPMLVGTVAAAASVVIALLLSPETKGKTLTAELVVA
Ga0210385_112775151	3300021402	Soil	IPMLVGTVAAAVSVVIALSLNPETKGKVLVAELSVA
Ga0187846_104815131	3300021476	Biofilm	IPMLVGTVVAAISVVISLLLSPETKGKVLVAELQVA
Ga0126371_113894921	3300021560	Tropical Forest Soil	YFQVGLVVPMLIATVAAATSVVIALLISPETKGTVLVAELQVA
Ga0213853_110632282	3300021861	Watersheds	SIPMLIGTCIGALSVAIALLLSPETKGKELTAELQIA
Ga0222728_11256711	3300022508	Soil	QVGLVIPMLVGTVGASASVVTALLLSPETKGKELTAELVVA
Ga0242668_11090391	3300022529	Soil	VNYDMGYAIPMLGGTVAAAVSVGIALSLSPETKGKVLVAELQVA
Ga0242658_11500402	3300022530	Soil	YAIPMLVGTVAAAVSVVIALSLSPETKGKVLVAELQVA
Ga0224549_10399801	3300022840	Soil	VPVVLAFCSDYFGVGLVIPMLVGTVGAAASVVVSLLLSPETRGKELTSELVVA
Ga0209171_102171912	3300025320	Iron-Sulfur Acid Spring	FVPVVLAFCAEYFQVGLVIPMLVGTVAAAFSVVVALLLSPETKGQELSAELVVA
Ga0207706_107797533	3300025933	Corn Rhizosphere	ALPMFVGTVVAAVSVVIALSLSPETKGKELVADLAPA
Ga0207665_115291911	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	YAVPMLVGTVVAAFSVVIALLLSPETKGKELVADLVVA
Ga0207667_114652562	3300025949	Corn Rhizosphere	AVPMLVGTVVAAFSVVIALLLSPETKGKELVADLVVA
Ga0207651_107391402	3300025960	Switchgrass Rhizosphere	GYAVPMLVGTVFAAFSVVIALSLSPETKGKELVSDLVVA
Ga0209448_100557071	3300027783	Bog Forest Soil	EYYQVGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0209465_100276122	3300027874	Tropical Forest Soil	LAIPMMVGTAVGAGSFIIALLLSPETKGKVLVPDLQVA
Ga0209465_100851591	3300027874	Tropical Forest Soil	AEHYQLGLVTPMLVGTVAAASSVVIALLISPETRGKVLEAELQVA
Ga0209590_110713542	3300027882	Vadose Zone Soil	AVNYGMGYGTPMLIATVAAATSVVIALSLSPETKGQELTADLVVAGADD
Ga0209275_102078221	3300027884	Soil	PMAAGTIAAAVSVVIALLLSPETMGQELTADLVVAGADD
Ga0075395_113724691	3300030973	Soil	PMLVGTVVAAISVVISLLLSPETKGKVLVAELQVA
Ga0308189_100092233	3300031058	Soil	RLRHPMLAGTLVGAVGIVVSLLISPETKGKELEADLVVA
Ga0170823_160131831	3300031128	Forest Soil	PMLAGTVVAAISVVISLLLSPETKGTVLMAELQVA
Ga0170820_142977252	3300031446	Forest Soil	YNLGYAIPMLVGTVSAAVSVVIALSLSPETKGEVLVAELQVA
Ga0318541_100462111	3300031545	Soil	VIPMLAGTVIAASSVVVALLISPETKGKILEAELSVA
Ga0318573_104798192	3300031564	Soil	PMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0318573_107127731	3300031564	Soil	YYQVGLVIPMLVGTVAAATSVVIALLISPETKGKVLVAELQVA
Ga0310915_106310281	3300031573	Soil	VPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0310915_110592902	3300031573	Soil	LVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA
Ga0318561_106052501	3300031679	Soil	FLAEYFQVGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA
Ga0306918_115736022	3300031744	Soil	LVLTFLAEYYQVGLVIPMLIGTVAAATSVVIALLISPETKGTVLVSELQVA
Ga0318566_100609191	3300031779	Soil	YFQVGLVVPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0318548_105311632	3300031793	Soil	IPMLVGTVVAAASVVISLLLSPETKGTVLVAELSVA
Ga0318550_104817621	3300031797	Soil	LVIPMLIGTVAAATSVVIALLISPETKGTVLVSELQVA
Ga0310917_107479081	3300031833	Soil	QVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVSELQVA
Ga0318512_102346091	3300031846	Soil	PMLVGTVVAAVSVVISLLLSPETKGKALLAELSVA
Ga0318522_100764471	3300031894	Soil	EYYQVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVAELQVA
Ga0318520_101795561	3300031897	Soil	VGLVIPMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA
Ga0306921_123832481	3300031912	Soil	VIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA
Ga0310916_117250641	3300031942	Soil	YQVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA
Ga0306926_124126911	3300031954	Soil	AEYFQVGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA
Ga0306926_124238802	3300031954	Soil	FCAEFFQVGLVIPMMVGTVGAAASVVIALLLSPETKGKELTAELQVA
Ga0318530_101365761	3300031959	Soil	PMLVGTVVAAISVVIALLLSPETKGKVLVAELQVA
Ga0318530_102542181	3300031959	Soil	YYQVGLVIPMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA
Ga0318530_102928311	3300031959	Soil	YQIGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA
Ga0306922_122648781	3300032001	Soil	VIPMLVGTVAAATSVVIALLISPETKGTVLVAELQVA
Ga0318559_105437911	3300032039	Soil	VGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0318545_100279123	3300032042	Soil	FFAEYFQVGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0318556_100223763	3300032043	Soil	PMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA
Ga0318575_107271941	3300032055	Soil	PMLVGTVVAAVSVVISLLLSPETKGKVLVAELQVA
Ga0318533_103237043	3300032059	Soil	VGLVVPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0318533_112170881	3300032059	Soil	YDQVGLVIPMLVGTVAAATSVVIALLISPETKGKVLVAELQVA
Ga0318513_101111381	3300032065	Soil	YFQVGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0318513_101499262	3300032065	Soil	EYYQVGLVIPMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA
Ga0318553_104195782	3300032068	Soil	GLVVPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA
Ga0306924_106155902	3300032076	Soil	IGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA
Ga0306924_107475992	3300032076	Soil	IPMLAGTVIAASSVVVALLISPETKGKILEAELSVA
Ga0306924_122810422	3300032076	Soil	IAIPMLVSTVVAAVSVVISLLLSPETKGKVLVADLAVA
Ga0335078_115585572	3300032805	Soil	VLAASAEYFQIGLVIPMLVGTVGAGASVVVASRLSPETKGRELTA
Ga0335080_123141351	3300032828	Soil	AEYFQVGLVIPMMVGTVGAAASVVIALLLSPETKGKELTAELVVA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign