Basic Information | |
---|---|
Family ID | F096089 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 42 residues |
Representative Sequence | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQ |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.05 % |
% of genes near scaffold ends (potentially truncated) | 99.05 % |
% of genes from short scaffolds (< 2000 bps) | 96.19 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.429 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.286 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (38.095 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF01061 | ABC2_membrane | 89.52 |
PF00005 | ABC_tran | 4.76 |
PF08241 | Methyltransf_11 | 0.95 |
PF00282 | Pyridoxal_deC | 0.95 |
PF12698 | ABC2_membrane_3 | 0.95 |
PF12840 | HTH_20 | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.00 % |
Unclassified | root | N/A | 40.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001991|JGI24743J22301_10048414 | Not Available | 863 | Open in IMG/M |
3300004092|Ga0062389_104827197 | Not Available | 508 | Open in IMG/M |
3300005341|Ga0070691_10062630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1791 | Open in IMG/M |
3300005436|Ga0070713_101533987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 646 | Open in IMG/M |
3300005439|Ga0070711_100947861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 736 | Open in IMG/M |
3300005533|Ga0070734_10670042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
3300005538|Ga0070731_10519325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 793 | Open in IMG/M |
3300005541|Ga0070733_10144508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1540 | Open in IMG/M |
3300005563|Ga0068855_100924185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 920 | Open in IMG/M |
3300005602|Ga0070762_10982974 | Not Available | 578 | Open in IMG/M |
3300005614|Ga0068856_101689550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
3300005841|Ga0068863_101238258 | Not Available | 752 | Open in IMG/M |
3300006163|Ga0070715_10836148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
3300006914|Ga0075436_101471903 | Not Available | 517 | Open in IMG/M |
3300009090|Ga0099827_10127763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2055 | Open in IMG/M |
3300009520|Ga0116214_1148576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 872 | Open in IMG/M |
3300009545|Ga0105237_10434548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1318 | Open in IMG/M |
3300009545|Ga0105237_10846563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 921 | Open in IMG/M |
3300009700|Ga0116217_10636038 | Not Available | 663 | Open in IMG/M |
3300010398|Ga0126383_10791800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1031 | Open in IMG/M |
3300012210|Ga0137378_11346610 | Not Available | 629 | Open in IMG/M |
3300012359|Ga0137385_10307634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1363 | Open in IMG/M |
3300012984|Ga0164309_10677939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 815 | Open in IMG/M |
3300013105|Ga0157369_11501929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 685 | Open in IMG/M |
3300014166|Ga0134079_10183769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 866 | Open in IMG/M |
3300014969|Ga0157376_11972079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300015372|Ga0132256_101006784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 949 | Open in IMG/M |
3300016294|Ga0182041_10824329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 830 | Open in IMG/M |
3300016294|Ga0182041_11211638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
3300016357|Ga0182032_10341210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
3300016422|Ga0182039_11770025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 566 | Open in IMG/M |
3300017932|Ga0187814_10055656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis | 1456 | Open in IMG/M |
3300017959|Ga0187779_10945741 | Not Available | 595 | Open in IMG/M |
3300017973|Ga0187780_10728572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 716 | Open in IMG/M |
3300017994|Ga0187822_10041316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1268 | Open in IMG/M |
3300018001|Ga0187815_10137282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1034 | Open in IMG/M |
3300018085|Ga0187772_10273528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1152 | Open in IMG/M |
3300018086|Ga0187769_10234756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata | 1362 | Open in IMG/M |
3300020150|Ga0187768_1031792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1152 | Open in IMG/M |
3300021374|Ga0213881_10398952 | Not Available | 619 | Open in IMG/M |
3300021439|Ga0213879_10259752 | Not Available | 527 | Open in IMG/M |
3300021479|Ga0210410_10919690 | Not Available | 762 | Open in IMG/M |
3300021560|Ga0126371_10274570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1806 | Open in IMG/M |
3300024178|Ga0247694_1025848 | Not Available | 659 | Open in IMG/M |
3300024251|Ga0247679_1094948 | Not Available | 505 | Open in IMG/M |
3300024310|Ga0247681_1027980 | Not Available | 828 | Open in IMG/M |
3300025898|Ga0207692_10900970 | Not Available | 582 | Open in IMG/M |
3300025905|Ga0207685_10276887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 822 | Open in IMG/M |
3300025907|Ga0207645_10467204 | Not Available | 852 | Open in IMG/M |
3300025914|Ga0207671_10167043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1707 | Open in IMG/M |
3300025935|Ga0207709_10374402 | Not Available | 1082 | Open in IMG/M |
3300025945|Ga0207679_11117304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 723 | Open in IMG/M |
3300025949|Ga0207667_10847046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 909 | Open in IMG/M |
3300027604|Ga0208324_1190202 | Not Available | 547 | Open in IMG/M |
3300027725|Ga0209178_1351480 | Not Available | 552 | Open in IMG/M |
3300027729|Ga0209248_10137198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 731 | Open in IMG/M |
3300027857|Ga0209166_10636295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 540 | Open in IMG/M |
3300027869|Ga0209579_10344688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 806 | Open in IMG/M |
3300027910|Ga0209583_10366405 | Not Available | 676 | Open in IMG/M |
3300028828|Ga0307312_10510073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 794 | Open in IMG/M |
3300030053|Ga0302177_10626386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300030494|Ga0310037_10149823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
3300030503|Ga0311370_11771880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
3300030524|Ga0311357_10406397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1284 | Open in IMG/M |
3300030862|Ga0265753_1149834 | Not Available | 503 | Open in IMG/M |
3300030906|Ga0302314_10414476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
3300031544|Ga0318534_10807889 | Not Available | 527 | Open in IMG/M |
3300031545|Ga0318541_10842114 | Not Available | 512 | Open in IMG/M |
3300031549|Ga0318571_10297073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 606 | Open in IMG/M |
3300031564|Ga0318573_10774231 | Not Available | 515 | Open in IMG/M |
3300031681|Ga0318572_10651884 | Not Available | 627 | Open in IMG/M |
3300031681|Ga0318572_10659801 | Not Available | 623 | Open in IMG/M |
3300031716|Ga0310813_11128592 | Not Available | 720 | Open in IMG/M |
3300031747|Ga0318502_10291355 | Not Available | 959 | Open in IMG/M |
3300031748|Ga0318492_10645422 | Not Available | 566 | Open in IMG/M |
3300031751|Ga0318494_10189438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
3300031751|Ga0318494_10627131 | Not Available | 629 | Open in IMG/M |
3300031770|Ga0318521_10948630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 527 | Open in IMG/M |
3300031771|Ga0318546_10329069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1061 | Open in IMG/M |
3300031779|Ga0318566_10041031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2170 | Open in IMG/M |
3300031782|Ga0318552_10721866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 508 | Open in IMG/M |
3300031795|Ga0318557_10511943 | Not Available | 551 | Open in IMG/M |
3300031831|Ga0318564_10082259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1424 | Open in IMG/M |
3300031831|Ga0318564_10111090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata | 1219 | Open in IMG/M |
3300031890|Ga0306925_11584966 | Not Available | 637 | Open in IMG/M |
3300031894|Ga0318522_10258707 | Not Available | 660 | Open in IMG/M |
3300031897|Ga0318520_10300814 | Not Available | 966 | Open in IMG/M |
3300031942|Ga0310916_10610965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 926 | Open in IMG/M |
3300032008|Ga0318562_10163588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1284 | Open in IMG/M |
3300032008|Ga0318562_10342706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 869 | Open in IMG/M |
3300032041|Ga0318549_10368145 | Not Available | 648 | Open in IMG/M |
3300032042|Ga0318545_10178973 | Not Available | 757 | Open in IMG/M |
3300032052|Ga0318506_10101496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
3300032054|Ga0318570_10576095 | Not Available | 513 | Open in IMG/M |
3300032055|Ga0318575_10335682 | Not Available | 765 | Open in IMG/M |
3300032065|Ga0318513_10013640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3246 | Open in IMG/M |
3300032068|Ga0318553_10435972 | Not Available | 686 | Open in IMG/M |
3300032076|Ga0306924_11391311 | Not Available | 749 | Open in IMG/M |
3300032076|Ga0306924_12015676 | Not Available | 594 | Open in IMG/M |
3300032783|Ga0335079_11283065 | Not Available | 732 | Open in IMG/M |
3300032896|Ga0335075_10733253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 942 | Open in IMG/M |
3300032897|Ga0335071_10734910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 936 | Open in IMG/M |
3300032955|Ga0335076_10129320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2446 | Open in IMG/M |
3300033134|Ga0335073_10778568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
3300033158|Ga0335077_11269277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 717 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.71% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.76% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.81% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.81% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.86% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24743J22301_100484141 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLS |
Ga0062389_1048271972 | 3300004092 | Bog Forest Soil | VTVRTPDSGFESIEHRYDRLERFLPLLLLAVPLVPYVLSQSPTAGAFG |
Ga0070691_100626301 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAIG |
Ga0070713_1015339871 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTPDSSFEPLELRFERIQRFVPYLLLTFPLIPYVLSQNPSAG |
Ga0070711_1009478612 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVRTPDSGFESLEKRYESLSRIIPYLLLAIPLVPYALSQSPT |
Ga0070734_106700422 | 3300005533 | Surface Soil | VSAVTVRTPDSGFESLDQRFESLMRLAPYALLIVPLVPYVLSMSPSAGAFGV |
Ga0070731_105193252 | 3300005538 | Surface Soil | VSAVTVRTPDSGFESLERRFERIDRFIPYLLLAFPLLPYVFSQDPSAG |
Ga0070733_101445081 | 3300005541 | Surface Soil | VTVGTPDSGFESLERRYESLARVLQYVLLAVPLIPYVLVFRPSAGA |
Ga0068855_1009241852 | 3300005563 | Corn Rhizosphere | VNAVTVRTPDSGFENLERRYESVARLVPYLLLVVP |
Ga0070762_109829742 | 3300005602 | Soil | VALRTPDSGFESLFIRYEKFERLLPLLLLVLPLLPYVLSQSPSAAAAG |
Ga0068856_1016895502 | 3300005614 | Corn Rhizosphere | VNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAG |
Ga0068863_1012382581 | 3300005841 | Switchgrass Rhizosphere | VVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLS |
Ga0070715_108361482 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTPDSGFEPLELRFERIQRLVPYLLLTFPLIPYVLSQNPSAGAV |
Ga0075436_1014719032 | 3300006914 | Populus Rhizosphere | VTVRTPDSGFEALEQRYESASRFIPYLLLAVPLVPYLL |
Ga0099827_101277633 | 3300009090 | Vadose Zone Soil | VTVRTPDSGFEALEKRYESLSRVIPYLLLAVPLGPYALSQQPSAGAFG |
Ga0116214_11485762 | 3300009520 | Peatlands Soil | MTVSTPDSGLELLEQRYERLAHVIVYVLLAVPLIPY |
Ga0105237_104345483 | 3300009545 | Corn Rhizosphere | VSVVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAP |
Ga0105237_108465632 | 3300009545 | Corn Rhizosphere | VNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAP |
Ga0116217_106360382 | 3300009700 | Peatlands Soil | VTVRTPDSGFESIEQRFDRLERVIPFLLLAVPLIPYVLSQSPTAG |
Ga0126383_107918003 | 3300010398 | Tropical Forest Soil | VSAVTVRTPDSGFENIERRYESVARVVPYLLLVVPLIPYVLS |
Ga0137378_113466102 | 3300012210 | Vadose Zone Soil | MTVRTPDSGFENLDRRYESVARLVPYLLLVVPLIPYALSQ |
Ga0137385_103076343 | 3300012359 | Vadose Zone Soil | MSAVTVRTPDSGLENLERRHDSVARVVPYLLLVVPL |
Ga0164309_106779392 | 3300012984 | Soil | VSEVTVRTPDSGFEPLELRFERIQRLVPYLLLTFPLIPYVLSQ |
Ga0157369_115019291 | 3300013105 | Corn Rhizosphere | VSAVAVRTPDSGFENLERRYESVARLVPYLLLVVPFI |
Ga0134079_101837692 | 3300014166 | Grasslands Soil | VSTVAVRTPDSGFESLEQRYETLSRFIPYLLLAVPLVPYALSQ |
Ga0157376_119720791 | 3300014969 | Miscanthus Rhizosphere | VNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVL |
Ga0132256_1010067842 | 3300015372 | Arabidopsis Rhizosphere | VSAVTVRTPDSGFENLERRYETVARLVPYLLLVVPFIPYVLSQSPT |
Ga0182041_108243291 | 3300016294 | Soil | VTVRTPDSGFENLERRYESVARWVPYMLLVAPFIPY |
Ga0182041_112116381 | 3300016294 | Soil | VTVRTPDRGFIELEQRYEKLGRVLPYVLLGVPLIPYVLSQNPTTG |
Ga0182032_103412101 | 3300016357 | Soil | VSPVTVRTPDSGFEAVEQRYQSLTRVIPYLLLAVPLV |
Ga0182039_117700252 | 3300016422 | Soil | VTVRTPDSGFESIEHRYQRIQRFLPFLRLTVPLIPYVLS |
Ga0187814_100556563 | 3300017932 | Freshwater Sediment | VTVRTPDSGLESLERRYESLARVIQYVLLAIPLIPYVLVFRPSAG |
Ga0187779_109457412 | 3300017959 | Tropical Peatland | VRTPDSGLESIEQRYDSLLRLMPYLLLAVPLIPYALSEST |
Ga0187780_107285721 | 3300017973 | Tropical Peatland | VTVRTPDSSLESIEQRYDLVMRLVPYLLLAVPLIPYALSQSPTAG |
Ga0187822_100413162 | 3300017994 | Freshwater Sediment | VTVRTPDSGFESLERRFERIDRLIPYLLLAFPLLPYVFSENPSAG |
Ga0187815_101372823 | 3300018001 | Freshwater Sediment | MTVRTPDSNLESLEQRYDSLLRLLPFLLLTVPLLPYVLSQS |
Ga0187772_102735283 | 3300018085 | Tropical Peatland | VTVLTPDSGLESIEQRYDSLLRLMPYLLLAVPLIPYALSE |
Ga0187769_102347563 | 3300018086 | Tropical Peatland | VTARTPDSGLESIEQRYNWFLRLIPYLLLVVPLIPYALSQSP |
Ga0187768_10317921 | 3300020150 | Tropical Peatland | VTVRTPDSGFESLDRRYESIMRWLPYLLLAVPLVLYVLTQSPSAGAF |
Ga0213881_103989521 | 3300021374 | Exposed Rock | VRTPDSGFENLDRRYESAGRLVPFLLLVVPLVPYVLTQAPSAGAAGI |
Ga0213879_102597522 | 3300021439 | Bulk Soil | VTIRTPDSNLESLEQRYESIMRWVPYLVLAVPFLPYVLSQSPTTG |
Ga0210410_109196902 | 3300021479 | Soil | VTVRTPDSDIESMEQRYDSLLRLLPFLLLTVPLLPYFLSQRPTAGA |
Ga0126371_102745701 | 3300021560 | Tropical Forest Soil | VTVRTPDSGFENLDRRYESVARWVPFVLLVVPFIPYVLSQAPSAG |
Ga0247694_10258481 | 3300024178 | Soil | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPY |
Ga0247679_10949482 | 3300024251 | Soil | VVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQA |
Ga0247681_10279802 | 3300024310 | Soil | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAV |
Ga0207692_109009701 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTPDSGFEPLELRFERLQRFVPYLLLTFPLIPYVLSQNPSAG |
Ga0207685_102768872 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVTVRTPDSGFESLEKRYESLSRIIPYLLLVIPLVPYALSQS |
Ga0207645_104672042 | 3300025907 | Miscanthus Rhizosphere | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQ |
Ga0207671_101670431 | 3300025914 | Corn Rhizosphere | VNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAIG |
Ga0207709_103744023 | 3300025935 | Miscanthus Rhizosphere | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQA |
Ga0207679_111173041 | 3300025945 | Corn Rhizosphere | VRTPDSGFENLDRRYESAGRLVPFLLLVVPLILYVLTQTPSAGAA |
Ga0207667_108470461 | 3300025949 | Corn Rhizosphere | VNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPF |
Ga0208324_11902023 | 3300027604 | Peatlands Soil | VTVRTPDSSFESIEHRYERLERFLPLLLLAVPLVPYVLSQSP |
Ga0209178_13514802 | 3300027725 | Agricultural Soil | VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAI |
Ga0209248_101371982 | 3300027729 | Bog Forest Soil | VRTPDSSLESMEQRYDSLLRLLPFLLLTVPLLPYFLSQRPTAG |
Ga0209166_106362952 | 3300027857 | Surface Soil | VTVRTPDSSFEALEQKADQYARVLPYLLLAVPLIPYVL |
Ga0209579_103446881 | 3300027869 | Surface Soil | VSAVTVRTPDSGFESLDQRFESLMRLAPYALLIVPLVPYVLSMSPSAGAFG |
Ga0209583_103664051 | 3300027910 | Watersheds | VTVRTPDSGFESIEQRFERLERFLPFLLLSVPLIPYV |
Ga0307312_105100731 | 3300028828 | Soil | VVAVRTPDSGFESLEQRYETLSRFIPYLLLAVPLVPYVLS |
Ga0302177_106263861 | 3300030053 | Palsa | VALRTPDSGFESLESRYLAIERFLPFLLLMVPLLPYVLS |
Ga0310037_101498231 | 3300030494 | Peatlands Soil | VTVRTPDSSLESLEQRYDSLLRLLPFLLLTVPLLPYY |
Ga0311370_117718802 | 3300030503 | Palsa | VALRTPDSGFESLESRYLTIERFLPFLLLTVPLLPY |
Ga0311357_104063973 | 3300030524 | Palsa | VTVRTPDSGFEALESQADRLARVAPYLLLAVPLIP |
Ga0265753_11498342 | 3300030862 | Soil | VTARTPDSGFESIEHRYERLERFLPLLLLAVPLVPYVLS |
Ga0302314_104144761 | 3300030906 | Palsa | VALRTPDSGFESLESRYLTIERFLPFLLLTVPLLPYVLSQNPSAG |
Ga0318534_108078892 | 3300031544 | Soil | VTVRTPDSNLESVERRYELLLRLVPFLLLVFPLLPYALTQSPS |
Ga0318541_108421142 | 3300031545 | Soil | VTVRAPDSGFESLERRYESLMRVVPFVLLTFPLLP |
Ga0318571_102970731 | 3300031549 | Soil | VSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYALSQSPTAGAFG |
Ga0318573_107742312 | 3300031564 | Soil | VTVRTPDSGLESLERRYESIMRVLPYPLLAVPLVPYALTQNPTAGAFVIT |
Ga0318572_106518842 | 3300031681 | Soil | VTVRTPDSGLESLERRYESIMRVLPYPLLAVPLVPYALTQNPTAG |
Ga0318572_106598011 | 3300031681 | Soil | VSAVTVRTPDSGFEAVEQRYESLSRVIPFLLLAFPL |
Ga0310813_111285921 | 3300031716 | Soil | VSAVTVRTPDSGFENLERRYESVARLVPYLLLVVPLIPYVLSQSPS |
Ga0318502_102913552 | 3300031747 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLT |
Ga0318492_106454221 | 3300031748 | Soil | VVTVRTPDSGFESLERRFQRIDRFTPYLLLAFPLLPYVLSQNP |
Ga0318494_101894381 | 3300031751 | Soil | VSAVTVRTPDSGFEAVEQRYESLSRVIPFLLLAFP |
Ga0318494_106271311 | 3300031751 | Soil | VTVRTPDSGFESLERRFQRIDRFIPYLLLAFPLLPYVL |
Ga0318521_109486301 | 3300031770 | Soil | VSPVTVRTPDSGFEAVEQRYQSLTRVIPYLLLAVPLVPYALSQSPT |
Ga0318546_103290691 | 3300031771 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLIPYVITQN |
Ga0318566_100410311 | 3300031779 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQGP |
Ga0318552_107218661 | 3300031782 | Soil | VSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYAL |
Ga0318557_105119431 | 3300031795 | Soil | VTVNTPDSGLESLEQRYESLLRVLPYVLLAVPLIPYGLAQSPAGGAFGI |
Ga0318564_100822591 | 3300031831 | Soil | VTVNTPDSGLESLEQRYESLLRVLPYVLLAVPLIPYGLAQSPAGGAFGITAG |
Ga0318564_101110903 | 3300031831 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPY |
Ga0306925_115849661 | 3300031890 | Soil | VSAVTVRTPDSGFEAVEQRYESLSRVIPFLLLAFPLIPYVI |
Ga0318522_102587071 | 3300031894 | Soil | VTVNTPDSGLESLEQRYESLLRVLPYVLLAVPLIPYG |
Ga0318520_103008142 | 3300031897 | Soil | VTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYVLSQAP |
Ga0310916_106109651 | 3300031942 | Soil | VSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYALSQSPTAG |
Ga0318562_101635883 | 3300032008 | Soil | VTVRTPDSGFENIERRHESVARVVPYLVLVVPLIPY |
Ga0318562_103427062 | 3300032008 | Soil | VTVRTPDSGFESLERRFQRIDRFIPYLLLAFPLLPYVLSQNPSAGAV |
Ga0318549_103681451 | 3300032041 | Soil | VTVRTPDSGFESLERRFQRIDRFTPYLLLAFPLLPYVLSQN |
Ga0318545_101789731 | 3300032042 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQGPGAG |
Ga0318506_101014961 | 3300032052 | Soil | VSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYALSQSPT |
Ga0318570_105760952 | 3300032054 | Soil | VTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYILSQAPS |
Ga0318575_103356821 | 3300032055 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQDPSAGAFAI |
Ga0318513_100136401 | 3300032065 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQDPS |
Ga0318553_104359722 | 3300032068 | Soil | VTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQGPG |
Ga0306924_113913112 | 3300032076 | Soil | VTVNTPDSGLESLERRYESIMRVLAYPLLAVPLIPYVLTQNPSAGAFAIT |
Ga0306924_120156762 | 3300032076 | Soil | VTVRTPDSGFENLERRYESVARWVPYLLLVAPFIP |
Ga0335079_112830651 | 3300032783 | Soil | VTVRTPDSGFESLERRFQRIDRFIPYLLLAFPLLPYVLS |
Ga0335075_107332532 | 3300032896 | Soil | VSAVTVRTPDSGFESLDQRFESLMRLAPYALLIVPLVPYVLSMSP |
Ga0335071_107349101 | 3300032897 | Soil | VTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYVLSQAPSAGAF |
Ga0335076_101293204 | 3300032955 | Soil | VTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYVLSQAPSA |
Ga0335073_107785683 | 3300033134 | Soil | VTVRTPDSGFESLEHRYESAARVVQYLLLVLPLLPYVL |
Ga0335077_112692772 | 3300033158 | Soil | VTARTPDSGLESLERRYERIERFLPGLLLAVPLIP |
⦗Top⦘ |