Basic Information | |
---|---|
Family ID | F095979 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 43 residues |
Representative Sequence | REPRTSGAAGRAALELAERVMASIQEHGERVQLLAFAAAQKTDK |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.10 % |
% of genes from short scaffolds (< 2000 bps) | 87.62 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.429 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.809 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.429 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF13103 | TonB_2 | 7.62 |
PF16360 | GTP-bdg_M | 2.86 |
PF01715 | IPPT | 1.90 |
PF01745 | IPT | 1.90 |
PF13167 | GTP-bdg_N | 0.95 |
PF01346 | FKBP_N | 0.95 |
PF01066 | CDP-OH_P_transf | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 1.90 |
COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.95 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.95 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.43 % |
Unclassified | root | N/A | 8.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459016|G1P06HT01CJ660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1094584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300001867|JGI12627J18819_10122560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
3300002912|JGI25386J43895_10105028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300002914|JGI25617J43924_10133729 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300002914|JGI25617J43924_10316038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10038549 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
3300004635|Ga0062388_101292964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300005367|Ga0070667_100229386 | Not Available | 1655 | Open in IMG/M |
3300005439|Ga0070711_101421412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300005518|Ga0070699_101069498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300005538|Ga0070731_10929398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300006174|Ga0075014_100611636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300006176|Ga0070765_101549551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300006800|Ga0066660_10674017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
3300006800|Ga0066660_10835581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300006904|Ga0075424_102402361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300009012|Ga0066710_103542523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300009088|Ga0099830_10044785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3089 | Open in IMG/M |
3300009088|Ga0099830_10622600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
3300009088|Ga0099830_11367566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300009090|Ga0099827_10050696 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
3300009137|Ga0066709_102806773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300009143|Ga0099792_10587505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
3300009792|Ga0126374_11570003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300010335|Ga0134063_10284792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300010358|Ga0126370_10133209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1783 | Open in IMG/M |
3300010359|Ga0126376_10147231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1881 | Open in IMG/M |
3300010396|Ga0134126_11852718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300010858|Ga0126345_1032665 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300011269|Ga0137392_10040319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3455 | Open in IMG/M |
3300012096|Ga0137389_10756042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300012189|Ga0137388_10954091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300012351|Ga0137386_10834272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300012363|Ga0137390_11833736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300012582|Ga0137358_10235957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1246 | Open in IMG/M |
3300012918|Ga0137396_10042821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3069 | Open in IMG/M |
3300012918|Ga0137396_10249164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
3300012918|Ga0137396_10333722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1122 | Open in IMG/M |
3300012922|Ga0137394_10838194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300012923|Ga0137359_11054253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300012944|Ga0137410_10378401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
3300014199|Ga0181535_10175482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
3300016750|Ga0181505_10274173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300017955|Ga0187817_10380386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
3300017959|Ga0187779_10281929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
3300020579|Ga0210407_10857016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
3300020579|Ga0210407_11087965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300020580|Ga0210403_10066084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2902 | Open in IMG/M |
3300020583|Ga0210401_10054196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3784 | Open in IMG/M |
3300020583|Ga0210401_10354229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
3300020583|Ga0210401_11022979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300021046|Ga0215015_10823242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300021086|Ga0179596_10145613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
3300021086|Ga0179596_10585632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300021170|Ga0210400_11462608 | Not Available | 543 | Open in IMG/M |
3300021178|Ga0210408_11017696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300021401|Ga0210393_10053798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3167 | Open in IMG/M |
3300021401|Ga0210393_11232290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300021402|Ga0210385_10957075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300021403|Ga0210397_10075475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2221 | Open in IMG/M |
3300021403|Ga0210397_10967085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300021404|Ga0210389_10699162 | Not Available | 794 | Open in IMG/M |
3300021406|Ga0210386_10222346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
3300021406|Ga0210386_10694104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300021474|Ga0210390_10393871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
3300021475|Ga0210392_10246409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
3300021475|Ga0210392_10431438 | Not Available | 964 | Open in IMG/M |
3300021475|Ga0210392_10457025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
3300021478|Ga0210402_10045489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3827 | Open in IMG/M |
3300021479|Ga0210410_11026328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300021559|Ga0210409_11562598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300021560|Ga0126371_10995554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300024182|Ga0247669_1039299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300025986|Ga0207658_10203325 | Not Available | 1655 | Open in IMG/M |
3300026316|Ga0209155_1188322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300026542|Ga0209805_1284937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300027097|Ga0208861_103380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300027370|Ga0209010_1066682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300027512|Ga0209179_1084525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300027535|Ga0209734_1042729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300027562|Ga0209735_1125294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300027635|Ga0209625_1061671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300027767|Ga0209655_10000127 | All Organisms → cellular organisms → Bacteria | 27662 | Open in IMG/M |
3300027842|Ga0209580_10117396 | Not Available | 1296 | Open in IMG/M |
3300027846|Ga0209180_10024170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3235 | Open in IMG/M |
3300027869|Ga0209579_10740435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300027895|Ga0209624_10276718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300027986|Ga0209168_10243618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
3300028536|Ga0137415_10601455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
3300028906|Ga0308309_10325917 | Not Available | 1304 | Open in IMG/M |
3300028906|Ga0308309_11152220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300028906|Ga0308309_11657791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300030596|Ga0210278_1142322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300031057|Ga0170834_114039466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300031231|Ga0170824_103675591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300031754|Ga0307475_10265685 | Not Available | 1375 | Open in IMG/M |
3300031754|Ga0307475_10593764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
3300031823|Ga0307478_10070495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2642 | Open in IMG/M |
3300031823|Ga0307478_11542501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300031962|Ga0307479_10708169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300031962|Ga0307479_10839953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300032205|Ga0307472_100915701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300032515|Ga0348332_10292312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.95% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.62% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.81% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.86% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.95% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.95% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027097 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF019 (SPAdes) | Environmental | Open in IMG/M |
3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2ZMR_00034680 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | AVRTRREPRTNGAAGRAALELASRVMASIQEHGERVQVAAFASKEKAGK |
AF_2010_repII_A100DRAFT_10945841 | 3300000655 | Forest Soil | RKEPPTNGAAGRAALELAGRVMASIQEHAARVQPEALAARENTTL* |
JGI12627J18819_101225601 | 3300001867 | Forest Soil | VRTRTEPRVNGAAGRAALELAARVMASIQEHGERVQLVAFAAAQKTEK* |
JGI25386J43895_101050281 | 3300002912 | Grasslands Soil | EPRTNGAAGRAALELASRVMASIQEHAARVQXGSFATQDKTR* |
JGI25617J43924_101337292 | 3300002914 | Grasslands Soil | FIDAARSRKEPRTNGAAGRAALELASRVMASIQEHAARVQIGSFATQDKTR* |
JGI25617J43924_103160382 | 3300002914 | Grasslands Soil | RREPRTNGAAGRAALELAGRVMASIQEHAARVQIGTFAIQDKTR* |
JGIcombinedJ51221_100385491 | 3300003505 | Forest Soil | NGAAGRAVLELATRVMASIQEHGERVQLAAFASQEKAGK* |
Ga0062388_1012929641 | 3300004635 | Bog Forest Soil | LEAARTRREPRTNGTAGRAALELATRVMASIQEHGERVQLAAFASQEKAGR* |
Ga0070667_1002293861 | 3300005367 | Switchgrass Rhizosphere | SGSAGRAALEVAERVMASIQEHGERVQLLAFSAAQKTEK* |
Ga0070711_1014214122 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PRTSGTAGRAALEVAERVMASIQEHGERVQLLAFSTAQKTER* |
Ga0070699_1010694982 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGRAALELAGRVMASIQEHSERVQLVAFAAAQKIENDS* |
Ga0070731_109293982 | 3300005538 | Surface Soil | GRAALELASRVMASIHEHADRVQVGAFAAQAKTDK* |
Ga0075018_107415822 | 3300006172 | Watersheds | RAALELAGRVMTSILEHAERVQLGAFSTQQKANL* |
Ga0075014_1006116362 | 3300006174 | Watersheds | EAARTRREPRTSGRSGRAALELAERVMASIQEHGERVQLSAFAAAQKTDE* |
Ga0070765_1015495511 | 3300006176 | Soil | RAALELAERVMASIQEHGERVQLSSFAAAQKTDE* |
Ga0066660_106740171 | 3300006800 | Soil | NGAAGRAALELATRVMASIQEHAARVQIGSFATQDKTR* |
Ga0066660_108355812 | 3300006800 | Soil | PTNGAAGREALALAGRVMASIQEHAARVQPEALAAREITTL* |
Ga0075424_1024023611 | 3300006904 | Populus Rhizosphere | RTSGTAGRAALEVAERVMASIQEHGQRVQLLAFSTAQKTER* |
Ga0066710_1035425232 | 3300009012 | Grasslands Soil | NGPAGRAALELATRVMASIQEHGDRVQLGAFSTQQKANR |
Ga0099830_100447854 | 3300009088 | Vadose Zone Soil | SFVDAVRMRSEPRVNGEAGRADLELAGRVMARIKEHGERVQLVAFAAAQKTEK* |
Ga0099830_106226001 | 3300009088 | Vadose Zone Soil | SGAAGRAALELAGRVMSSIQEHAERVQLSALAAPSKTGK* |
Ga0099830_113675661 | 3300009088 | Vadose Zone Soil | GAAGRAALELAGRVMASIQEHAARVQLGSFATQAKTR* |
Ga0099827_100506965 | 3300009090 | Vadose Zone Soil | VRIGASPRVDGAAGRRALELADRVVASILDHGRRVQLGAFAIH* |
Ga0066709_1028067732 | 3300009137 | Grasslands Soil | HAELEAFIDAVRPRRQPRTSGKAGRAALEVAESVMASIQEHGERVQLLAFSATQKIEK* |
Ga0099792_105875052 | 3300009143 | Vadose Zone Soil | LNAVRTRNEPRTNGAAGRAALELAVRVMASIQEHAARVQIGSFATQDKTR* |
Ga0126374_115700032 | 3300009792 | Tropical Forest Soil | RTSGAAGRIALELAERVMASIQEHGERVQLLAFASAQKTEK* |
Ga0134063_102847921 | 3300010335 | Grasslands Soil | KEPRTNGTAGRAALELATRVMASIQEHAARVQIGSFATQDKTR* |
Ga0126370_101332091 | 3300010358 | Tropical Forest Soil | KEPPTNGTAGRAALALAGRVMASIQEHAARVQPEALAARENTRE* |
Ga0126376_101472311 | 3300010359 | Tropical Forest Soil | AVRAALELAGRVMASIQEHAARVQPEALAARENTTL* |
Ga0134126_118527182 | 3300010396 | Terrestrial Soil | AVRTRREPRTSGTAGRAALEVAERVMASIQEHGERVQLLAFSAAQKTEK* |
Ga0126345_10326652 | 3300010858 | Boreal Forest Soil | AELQAFLDSVGTRREPRTSGASGRAALELASRVMASIQEHGERVQLAAFASQEKAGK* |
Ga0137392_100403195 | 3300011269 | Vadose Zone Soil | FVDAARSRQEPRTNGAAGRAALELAGRVMASIQEHAARVQIGSFATQDKTR* |
Ga0137389_107560421 | 3300012096 | Vadose Zone Soil | VNGAAGRAALELAARVMTSIQEHGERVQLVAFAAAQKIDK* |
Ga0137388_109540911 | 3300012189 | Vadose Zone Soil | EPRTNGAAGRAAIELASRVMANIQEHAARVQIGSFATQDKTR* |
Ga0137386_108342721 | 3300012351 | Vadose Zone Soil | TRKEPPTNGAAGRAALALAGRVMASIQEHAARVQPEALAARENSTT* |
Ga0137390_118337362 | 3300012363 | Vadose Zone Soil | FVDSVRTRKEPRVNGAAGRAALELAARVMTSIQEHGERVQLVAFAAAQKIDK* |
Ga0137358_102359571 | 3300012582 | Vadose Zone Soil | RTEPRVNGAAGRAALELAARVMASIQERGERVQLVAFAAAQKTENDS* |
Ga0137396_100428214 | 3300012918 | Vadose Zone Soil | GRAALELAARVMASIQEHGERVQLLAFAAAQKTEK* |
Ga0137396_102491642 | 3300012918 | Vadose Zone Soil | AGRAALELAARVMASIQEHGERVQLVAFAAAQKTEK* |
Ga0137396_103337222 | 3300012918 | Vadose Zone Soil | VNASRSRKEPRTNGAAGRAALELATRVMASIQEHAARVQIGSFATQDKTR* |
Ga0137394_108381941 | 3300012922 | Vadose Zone Soil | GRAALELAARVMASIQEHGERVQLVAFAAAQKTEK* |
Ga0137359_110542531 | 3300012923 | Vadose Zone Soil | AFVDAARTRKEPKTNGAAGRAALELASRVMASIQEHAERVQLEAVSSHEKATR* |
Ga0137410_103784012 | 3300012944 | Vadose Zone Soil | RAALELASRVMASIQEHAERVQLEAVSSQEKTTR* |
Ga0181535_101754821 | 3300014199 | Bog | VRTRVAPKTDGAAGRAALELANAVMASIREHAARVQPVALTGVEKT* |
Ga0181505_102741732 | 3300016750 | Peatland | DGAAGRAALELANAVMASIREHAARVQPVALTGVEKT |
Ga0187817_103803861 | 3300017955 | Freshwater Sediment | AVRTRREPRTNGAAGRAALELASRVMASIQEHGERVQLAAFASQEKAGK |
Ga0187779_102819291 | 3300017959 | Tropical Peatland | EAGRAALELASRVMASILEHGDRVQLAAFSAPQKVN |
Ga0210407_108570161 | 3300020579 | Soil | AVRTRREPPTNGAAGRAALELATRVMASIQEHGERVQLAAFASQEKAGK |
Ga0210407_110879651 | 3300020579 | Soil | WLAEQFGRAALELASRVMASIQEHCERVQLAAFASQEKAGK |
Ga0210403_100660845 | 3300020580 | Soil | WRAALELASRVMESIREHEARVQPVAQSKREKMNQ |
Ga0210401_100541961 | 3300020583 | Soil | REPRTNGTAGRAALELASRVMASIQEHGARVQVAAFASQEKAGK |
Ga0210401_103542291 | 3300020583 | Soil | TRREPPTNGAAGRAALELATRVMASIQEHGERVQIAAFASQEKAGK |
Ga0210401_110229792 | 3300020583 | Soil | RTSGRSGRAALELAQRVMASIQEHGERVQLSAFAAAQKTDE |
Ga0215015_108232422 | 3300021046 | Soil | VDAVRTGSEPRVDGAAGRAALELAARVMASIQEHGERVQLVAFAAAQKTET |
Ga0179596_101456131 | 3300021086 | Vadose Zone Soil | RTEPRVNGAAGRAALELAARVMASIQEHGERVQLVAFAAAQKTEK |
Ga0179596_105856322 | 3300021086 | Vadose Zone Soil | FINAVRSRKEPRTNGVAGRAALELAGRVMASIQEHAERVQIGTFAIQDKTR |
Ga0210400_114626082 | 3300021170 | Soil | RAGRAALDLAQRVMTSIQEHGERVQLLAFAAAQKIDE |
Ga0210408_110176962 | 3300021178 | Soil | REPRTSGAAGRAALELAERVMASIQEHGERVQLLAFAAAQKTDK |
Ga0210393_100537984 | 3300021401 | Soil | AAGRAALELASRVMASIQEHGERVQLAAFASQEKAGK |
Ga0210393_112322902 | 3300021401 | Soil | FLEAVGTRREPPTNGAAGRAALELASRVMASIQEHGERVQLAAFASQEKAGK |
Ga0210385_109570751 | 3300021402 | Soil | GGRAGRAALDLAQRVMTSIQEHGERVQLLAFAAAQKIDE |
Ga0210397_100754751 | 3300021403 | Soil | TEPRTNGAAGRAALELASRVMASIQEHGARVQVAAFASQEKAGK |
Ga0210397_109670851 | 3300021403 | Soil | AGRAALELATRVMASIQEHGERVQLAAFASQEKAGK |
Ga0210389_106991622 | 3300021404 | Soil | AGRAALDLAQRVMTSIQEHGERVQLLAFAAAQKIDE |
Ga0210386_102223461 | 3300021406 | Soil | GAAGRAALELATRVMASIQEHGERVQLAAFASQEKAGK |
Ga0210386_106941042 | 3300021406 | Soil | TGGRAGRAALDLAQRVMTSIQEHGERVQLLAFAAAQKIDE |
Ga0210390_103938711 | 3300021474 | Soil | PTNGAAGRAALELASRVMASIQEHGERVQLAAFASQEKAGK |
Ga0210392_102464092 | 3300021475 | Soil | CVRTRREPRTGGRAGRAALDLAQRVMTSIQEHGERVQLLAFAAAQKIDE |
Ga0210392_104314382 | 3300021475 | Soil | ELEEFLDCIRTRREPRTGGRAGRAALDLAQRVMTSIHEHGERVQLLAFAAAQKIDE |
Ga0210392_104570252 | 3300021475 | Soil | EPGTAGRAGRAALDLAQRVMTSIQEHGERVQLLAFAAAQKIDE |
Ga0210402_100454891 | 3300021478 | Soil | EPRTNGAAGRAALELASRVMASIQEHAARVQIGTFATQDKTR |
Ga0210410_110263282 | 3300021479 | Soil | GTAGRAALELASRVMASIQEHGARVQVAAFASQEKAGK |
Ga0210409_115625981 | 3300021559 | Soil | RTRSEPRVNGAAGRAALELAARVMASIQEHGERVQLVAFAAAQKTDK |
Ga0126371_109955542 | 3300021560 | Tropical Forest Soil | VRTRREPRTDGVAGRAALELASRVMASIHEHADRVQVGAFAAQAKTDK |
Ga0247669_10392991 | 3300024182 | Soil | RREPRTNGAAGRAALELASRVMASIQEHGERVQVAAFASREKARK |
Ga0207658_102033253 | 3300025986 | Switchgrass Rhizosphere | SGSAGRAALEVAERVMASIQEHGERVQLLAFSAAQKTEK |
Ga0209155_11883222 | 3300026316 | Soil | AAGRAALALAGRVMASIQEHAARVQPEALAARENSTT |
Ga0209805_12849371 | 3300026542 | Soil | RTSGKAGRAALEVAESVMASIQEHGERVQLLAFSATQKIEK |
Ga0208861_1033801 | 3300027097 | Forest Soil | QFGRAASELASHVLASIQEHGERVQLAAFASQEKAGK |
Ga0209010_10666821 | 3300027370 | Forest Soil | TGRAALELAERVMASIQEHGERVQLLAFATAQKTDK |
Ga0209179_10845252 | 3300027512 | Vadose Zone Soil | RTRTEPRVNGAAGRAALELAARVMASIQEHGERVQLVAFAAAQKTEK |
Ga0209734_10427291 | 3300027535 | Forest Soil | AVRTRTEPRVNGAAGRAALELAARVMASIQEHGERVQLAAFAAAQKIDK |
Ga0209735_11252941 | 3300027562 | Forest Soil | TRSEPRVNGEAGRAALELAGRVMASIQEHGERVQLLAFAAAQKTEK |
Ga0209625_10616711 | 3300027635 | Forest Soil | ELEAFVESVRSRHEPRTSGRSGRAALELAERVMASIQEHGERVQLSAFAAAQKTDE |
Ga0209655_100001271 | 3300027767 | Bog Forest Soil | TRREPPTSGAAGRAALELATRVMGSIQEHGERVQLAAFASQEKAGK |
Ga0209580_101173961 | 3300027842 | Surface Soil | SSSAAGRAALELAARVMASIQEHGERVQLVAFAAAQKTDK |
Ga0209180_100241701 | 3300027846 | Vadose Zone Soil | VRTRREPRTNGAAGRAALELASRVMASIQEHGERVQLAAFATEEKAKK |
Ga0209579_107404351 | 3300027869 | Surface Soil | GAAGRAALELASRVMASIHEHADRVQVGAFAAQAKTDK |
Ga0209624_102767181 | 3300027895 | Forest Soil | PRTSGRAGRAALELAERVMSSIQEHGERVQLLAFATAQKTNE |
Ga0209168_102436181 | 3300027986 | Surface Soil | RTGGRAGRAALDLAQRVMTSIQEHGERVQLLAFAAAQKIDE |
Ga0137415_106014551 | 3300028536 | Vadose Zone Soil | SRKEPRTNGAAGRAALELAGRVMASIQEHAARVQIGSLATQDKAR |
Ga0308309_103259172 | 3300028906 | Soil | PRTGGRAGRAALELAERVMASIQEHGERVQLSSFAAAQKTDE |
Ga0308309_111522202 | 3300028906 | Soil | RTNGAAGRAALELATRVMASIQEHGERVQLAAFASQEKAGK |
Ga0308309_116577911 | 3300028906 | Soil | VGTRREPRTNGAAGRAALELASRVMASIQEHGERVQLAAFASQEKAGK |
Ga0210278_11423221 | 3300030596 | Soil | AFLEAVGTRREPPTNGAAGRAALELASGVMASIQEHGERVQLAAFVSQEKAGK |
Ga0170834_1140394661 | 3300031057 | Forest Soil | GRAALELASRVMASIQEHGERVQLAAFASQEKAGK |
Ga0170824_1036755911 | 3300031231 | Forest Soil | DAVRTRREPRTGGRAGRAALDLAERVMASIQGHAERVQLLAFAAAQKIDE |
Ga0307475_102656851 | 3300031754 | Hardwood Forest Soil | VRTRSEPRVNGAAGRAALELAARVMASIQEHGERVQLVAFAAAQKTDK |
Ga0307475_105937642 | 3300031754 | Hardwood Forest Soil | GAAGRAALELASRVMASIQEHGERVQLAAFASQEKAGK |
Ga0307478_100704951 | 3300031823 | Hardwood Forest Soil | GAAGRAALELAGRVMASIQEHAARVQLGTFATQDKTR |
Ga0307478_115425012 | 3300031823 | Hardwood Forest Soil | AEQFGRTALELASRVMASIQEHHERVQLAAFASQEKAGK |
Ga0307479_107081691 | 3300031962 | Hardwood Forest Soil | AGRAALELAVRVMASIQEHGERVQLVAFAAAQKTEK |
Ga0307479_108399532 | 3300031962 | Hardwood Forest Soil | FLDAVSTRCEPRTSGTAGRAALELAARVMTSIQEHGERVQLLAFAATQKTDK |
Ga0307472_1009157012 | 3300032205 | Hardwood Forest Soil | SFVDSVRTRNEPRVNGAAGRAALELAGRVMASIQEHGERVQLVAFAGAQKSEK |
Ga0348332_102923122 | 3300032515 | Plant Litter | FLEAVGTRREPPTNGAAGRAALELASRVMASIQEHGERVQPAAFASQEKAGK |
⦗Top⦘ |