Metagenome Family F094926

Basic Information
Family ID	F094926
Family Type	Metagenome
Number of Sequences	105
Average Sequence Length	44 residues
Representative Sequence	MRVSLIFVIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN
Number of Associated Samples	16
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	66.35 %
% of genes near scaffold ends (potentially truncated)	34.29 %
% of genes from short scaffolds (< 2000 bps)	45.71 %
Associated GOLD sequencing projects	16
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Most Common Taxonomy
Group	Unclassified (70.476 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (58.095 % of family members)
Environment Ontology (ENVO)	Unclassified (58.095 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (60.952 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF04934	Med6	1.90
PF02622	DUF179	0.95
PF16121	40S_S4_C	0.95
PF00696	AA_kinase	0.95
PF17177	PPR_long	0.95
PF00069	Pkinase	0.95
PF00890	FAD_binding_2	0.95
PF07714	PK_Tyr_Ser-Thr	0.95
PF13359	DDE_Tnp_4	0.95
PF02535	Zip	0.95
PF00092	VWA	0.95
PF14312	FG-GAP_2	0.95
PF02383	Syja_N	0.95
PF03159	XRN_N	0.95
PF02689	Herpes_Helicase	0.95
PF03055	RPE65	0.95
PF01189	Methyltr_RsmB-F	0.95

COG ID	Name	Functional Category	% Frequency in 105 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	7.62
COG0144	16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family	Translation, ribosomal structure and biogenesis [J]	0.95
COG0428	Zinc transporter ZupT	Inorganic ion transport and metabolism [P]	0.95
COG1678	Putative transcriptional regulator, AlgH/UPF0301 family	Transcription [K]	0.95
COG3670	Carotenoid cleavage dioxygenase or a related enzyme	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
All Organisms	root	All Organisms	29.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
cellular organisms	root	All Organisms → cellular organisms	29.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	29.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	25.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Stramenopiles	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles	24.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Ochrophyta	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta	24.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Bacillariophyta	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	24.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Coscinodiscophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae	18.10 %
Bacillariophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Thalassiosirophycidae	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae	18.10 %
Bacillariophycidae	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Thalassiosirales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	18.10 %
Bacillariales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Thalassiosiraceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae	13.33 %
Skeletonemataceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae	1.90 %
Bacillariaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Thalassiosira	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	13.33 %
Skeletonema	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema	1.90 %
Fragilariopsis	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Thalassiosira oceanica	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	6.67 %
Thalassiosira pseudonana	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	5.71 %
Skeletonema marinoi-dohrnii complex	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex	1.90 %
Fragilariopsis cylindrus	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.48 %
Thalassiosira oceanica	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	6.67 %
Thalassiosira pseudonana	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	5.71 %
Skeletonema marinoi	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	1.90 %
Fragilariopsis cylindrus CCMP1102	strain	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002408\|B570J29032_109158204	Not Available	615	Open in IMG/M
3300007636\|Ga0102856_1014333	Not Available	1126	Open in IMG/M
3300007636\|Ga0102856_1017580	Not Available	1033	Open in IMG/M
3300008263\|Ga0114349_1003563	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	8708	Open in IMG/M
3300008263\|Ga0114349_1007086	Not Available	5605	Open in IMG/M
3300008263\|Ga0114349_1007330	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	6002	Open in IMG/M
3300008263\|Ga0114349_1013596	All Organisms → cellular organisms → Eukaryota → Sar	4092	Open in IMG/M
3300008263\|Ga0114349_1017710	Not Available	3591	Open in IMG/M
3300008263\|Ga0114349_1023969	Not Available	3072	Open in IMG/M
3300008263\|Ga0114349_1027783	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	2835	Open in IMG/M
3300008263\|Ga0114349_1033146	Not Available	2572	Open in IMG/M
3300008263\|Ga0114349_1037143	Not Available	2412	Open in IMG/M
3300008263\|Ga0114349_1052347	Not Available	1961	Open in IMG/M
3300008263\|Ga0114349_1065775	All Organisms → cellular organisms → Eukaryota	4088	Open in IMG/M
3300008263\|Ga0114349_1073399	Not Available	1578	Open in IMG/M
3300008263\|Ga0114349_1083052	Not Available	1450	Open in IMG/M
3300008263\|Ga0114349_1084079	Not Available	1438	Open in IMG/M
3300008263\|Ga0114349_1107659	Not Available	1201	Open in IMG/M
3300008263\|Ga0114349_1145668	Not Available	949	Open in IMG/M
3300008263\|Ga0114349_1150661	Not Available	924	Open in IMG/M
3300008263\|Ga0114349_1167695	Not Available	846	Open in IMG/M
3300008263\|Ga0114349_1253264	Not Available	568	Open in IMG/M
3300008265\|Ga0114361_1000132	All Organisms → cellular organisms → Eukaryota	14522	Open in IMG/M
3300008265\|Ga0114361_1000208	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	12692	Open in IMG/M
3300008265\|Ga0114361_1000211	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	12678	Open in IMG/M
3300008265\|Ga0114361_1000900	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	9069	Open in IMG/M
3300008265\|Ga0114361_1001807	All Organisms → cellular organisms → Eukaryota	7384	Open in IMG/M
3300008265\|Ga0114361_1002423	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	6734	Open in IMG/M
3300008265\|Ga0114361_1002504	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	6638	Open in IMG/M
3300008265\|Ga0114361_1003355	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	9563	Open in IMG/M
3300008265\|Ga0114361_1003698	Not Available	5751	Open in IMG/M
3300008265\|Ga0114361_1005321	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	8071	Open in IMG/M
3300008265\|Ga0114361_1005489	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	11052	Open in IMG/M
3300008265\|Ga0114361_1006247	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	4625	Open in IMG/M
3300008265\|Ga0114361_1008142	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	5559	Open in IMG/M
3300008265\|Ga0114361_1008369	Not Available	4024	Open in IMG/M
3300008265\|Ga0114361_1008849	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3905	Open in IMG/M
3300008265\|Ga0114361_1008983	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	3876	Open in IMG/M
3300008265\|Ga0114361_1009393	Not Available	4192	Open in IMG/M
3300008265\|Ga0114361_1009412	Not Available	3782	Open in IMG/M
3300008265\|Ga0114361_1009433	Not Available	3778	Open in IMG/M
3300008265\|Ga0114361_1009640	Not Available	3734	Open in IMG/M
3300008265\|Ga0114361_1010768	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	5905	Open in IMG/M
3300008265\|Ga0114361_1011638	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	3383	Open in IMG/M
3300008265\|Ga0114361_1012981	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3179	Open in IMG/M
3300008265\|Ga0114361_1013145	Not Available	3155	Open in IMG/M
3300008265\|Ga0114361_1013299	Not Available	3133	Open in IMG/M
3300008265\|Ga0114361_1014746	All Organisms → cellular organisms → Eukaryota	2947	Open in IMG/M
3300008265\|Ga0114361_1014799	Not Available	2940	Open in IMG/M
3300008265\|Ga0114361_1015458	Not Available	2869	Open in IMG/M
3300008265\|Ga0114361_1019639	Not Available	2461	Open in IMG/M
3300008265\|Ga0114361_1019669	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	3829	Open in IMG/M
3300008265\|Ga0114361_1020294	Not Available	2411	Open in IMG/M
3300008265\|Ga0114361_1022370	Not Available	2257	Open in IMG/M
3300008265\|Ga0114361_1022998	Not Available	2782	Open in IMG/M
3300008265\|Ga0114361_1026583	Not Available	2011	Open in IMG/M
3300008265\|Ga0114361_1040133	Not Available	1525	Open in IMG/M
3300008265\|Ga0114361_1043177	Not Available	1454	Open in IMG/M
3300008265\|Ga0114361_1046351	Not Available	1391	Open in IMG/M
3300008265\|Ga0114361_1056449	Not Available	1235	Open in IMG/M
3300008265\|Ga0114361_1081512	Not Available	1004	Open in IMG/M
3300008265\|Ga0114361_1085171	Not Available	980	Open in IMG/M
3300008265\|Ga0114361_1153284	Not Available	719	Open in IMG/M
3300008265\|Ga0114361_1215680	Not Available	596	Open in IMG/M
3300020048\|Ga0207193_1120089	Not Available	2311	Open in IMG/M
3300020505\|Ga0208088_1048757	Not Available	506	Open in IMG/M
3300021108\|Ga0214162_1060270	Not Available	625	Open in IMG/M
3300033984\|Ga0334989_0019246	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3612	Open in IMG/M
3300033984\|Ga0334989_0042518	Not Available	2481	Open in IMG/M
3300033984\|Ga0334989_0136231	Not Available	1364	Open in IMG/M
3300033984\|Ga0334989_0297680	Not Available	859	Open in IMG/M
3300033984\|Ga0334989_0456841	Not Available	644	Open in IMG/M
3300033984\|Ga0334989_0597119	Not Available	530	Open in IMG/M
3300034022\|Ga0335005_0030224	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102	3747	Open in IMG/M
3300034022\|Ga0335005_0032610	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	3588	Open in IMG/M
3300034022\|Ga0335005_0044135	Not Available	3029	Open in IMG/M
3300034022\|Ga0335005_0063733	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	2462	Open in IMG/M
3300034022\|Ga0335005_0360038	Not Available	846	Open in IMG/M
3300034022\|Ga0335005_0360149	Not Available	846	Open in IMG/M
3300034022\|Ga0335005_0509010	Not Available	668	Open in IMG/M
3300034022\|Ga0335005_0617955	Not Available	584	Open in IMG/M
3300034022\|Ga0335005_0767477	Not Available	502	Open in IMG/M
3300034064\|Ga0335001_0592385	Not Available	583	Open in IMG/M
3300034064\|Ga0335001_0742295	Not Available	510	Open in IMG/M
3300034068\|Ga0334990_0148262	Not Available	1280	Open in IMG/M
3300034068\|Ga0334990_0390662	Not Available	750	Open in IMG/M
3300034068\|Ga0334990_0527845	Not Available	626	Open in IMG/M
3300034095\|Ga0335022_0673048	Not Available	513	Open in IMG/M
3300034096\|Ga0335025_0467467	Not Available	641	Open in IMG/M
3300034107\|Ga0335037_0382183	Not Available	762	Open in IMG/M
3300034107\|Ga0335037_0730112	Not Available	515	Open in IMG/M
3300034167\|Ga0335017_0042082	Not Available	2692	Open in IMG/M
3300034167\|Ga0335017_0281682	Not Available	931	Open in IMG/M
3300034167\|Ga0335017_0295374	Not Available	904	Open in IMG/M
3300034167\|Ga0335017_0302341	Not Available	891	Open in IMG/M
3300034167\|Ga0335017_0477785	Not Available	663	Open in IMG/M
3300034168\|Ga0335061_0004623	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	6869	Open in IMG/M
3300034168\|Ga0335061_0006562	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	5895	Open in IMG/M
3300034168\|Ga0335061_0012527	Not Available	4413	Open in IMG/M
3300034168\|Ga0335061_0044964	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	2363	Open in IMG/M
3300034168\|Ga0335061_0079252	Not Available	1749	Open in IMG/M
3300034168\|Ga0335061_0472587	Not Available	641	Open in IMG/M
3300034168\|Ga0335061_0592596	Not Available	558	Open in IMG/M
3300034168\|Ga0335061_0627172	Not Available	538	Open in IMG/M

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	98.10%
Marine	Environmental → Aquatic → Marine	1.90%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	95.24%
Lentic	Environmental → Aquatic → Freshwater → Lentic	2.86%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.90%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	94.29%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	1.90%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.90%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.95%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.95%

Habitat	Taxonomy	Distribution
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	58.10%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	36.19%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.90%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.90%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.95%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.95%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300007636	Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3	Environmental	Open in IMG/M
3300008263	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR	Environmental	Open in IMG/M
3300008265	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020505	Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021108	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300033984	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034064	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054	Environmental	Open in IMG/M
3300034068	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034096	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098	Environmental	Open in IMG/M
3300034107	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133	Environmental	Open in IMG/M
3300034167	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082	Environmental	Open in IMG/M
3300034168	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183	Environmental	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29032_1091582041	3300002408	Freshwater	FAIIVSFMLFTVLFPLVYVLYFEEFLIHDSRGFMILKKI*
Ga0102856_10143332	3300007636	Estuarine	RVSLIFVIIISFMLFTVFSLVYVLYFEELLIHDSRGFMILKNN*
Ga0102856_10175802	3300007636	Estuarine	WAGGIVRVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKKI*
Ga0114349_10035639	3300008263	Freshwater, Plankton	MQVSLIFAIILSFMLFTVFTLANVLYFEEFLIYDSRGFMILKNS*
Ga0114349_10070867	3300008263	Freshwater, Plankton	MEEPRAIFATIVSFLLFTVFLLVYVLYFEEFLFHNSCGFMILKKN*
Ga0114349_10073302	3300008263	Freshwater, Plankton	VRVSLIFAIIVSFMLFTVFSLVNVLYFEEFLIHDSRGFMILKKI*
Ga0114349_10135967	3300008263	Freshwater, Plankton	VRVSLIFALIVSFMLFTVFPLVYVLYLEEFLIHDSRGFMILKKI*
Ga0114349_10177101	3300008263	Freshwater, Plankton	VRVSLIFAIIISFLLFTVFTLVYVLYFEECQIHDSRGFMILKNN*
Ga0114349_10239694	3300008263	Freshwater, Plankton	VRVSLIFAIIVSFMLFTVFTLAIVLYSRGFMILKNN*
Ga0114349_10277834	3300008263	Freshwater, Plankton	LVRVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSREFMSLKKT*
Ga0114349_10331463	3300008263	Freshwater, Plankton	VRVSLIFAIIISFMLFTVFTLANVLYFEEFMIHESRGFMILKNN*
Ga0114349_10371436	3300008263	Freshwater, Plankton	VQVSLIFGIIVSFMLFTVFTLANVLYFEEFMIHDSREFIILENN*
Ga0114349_10523473	3300008263	Freshwater, Plankton	MQVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKNGIL*
Ga0114349_10657751	3300008263	Freshwater, Plankton	VQVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFVILKKI*
Ga0114349_10733991	3300008263	Freshwater, Plankton	VRVSLIFAIIVSFMLFTYSTVFLLVYVLYFEEFLIHDSRGFMILKNN*
Ga0114349_10830521	3300008263	Freshwater, Plankton	SLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMI*
Ga0114349_10840794	3300008263	Freshwater, Plankton	VDPSSTVDMRVSPIFAIIVRFMLFTVFTLANLLYFEEFLIHDSHGFIILKNN*
Ga0114349_11076592	3300008263	Freshwater, Plankton	VRDSLIFAIIVSFMLFTVFPLVHVLCIEDFLIHDSRGFMILKKNDQI
Ga0114349_11456683	3300008263	Freshwater, Plankton	FVIIVSFMLFTMFPLIYVLYFEEFLIHDSHGFMILKKI*
Ga0114349_11506611	3300008263	Freshwater, Plankton	VRVSLVFVIIVSFMLFTVFTLVYVLYFEEFLIHDSRG
Ga0114349_11676952	3300008263	Freshwater, Plankton	VRVSLIFAIIISFMIFTVFPLIYVLYFEEFLIHDSRGFMILK
Ga0114349_12532641	3300008263	Freshwater, Plankton	MEEHVRVSLIFAIIISFMLFTMFTLVHVFYFEEFLIHDSRGFMILKNS*
Ga0114361_100013212	3300008265	Freshwater, Plankton	VQVSLIFAIIVSFMLFTVFPLVYVFYVEEFLIHDSRGFMILKYN*
Ga0114361_100020811	3300008265	Freshwater, Plankton	MCEFPRFFAKIVSFMLFTVFTLVYVLYFKEFLIHDSRGFVILKNS*
Ga0114361_10002111	3300008265	Freshwater, Plankton	VRVSLIFAIIISFMLFTMFPLANVFYFEEFLIHNSRGFMILKNN*
Ga0114361_100090014	3300008265	Freshwater, Plankton	VQVSLIFAIIVSFMLFTVFPLDNVLYFEEFLIHDSRGFMILKNK*
Ga0114361_10018075	3300008265	Freshwater, Plankton	VRVSLIFAIIVSFMLPFEEFLIHNSRGFMILKKIGPNLLGLCYFPLNT*
Ga0114361_10024236	3300008265	Freshwater, Plankton	VRVSLIFVIIVSFMLFTLFPLVYVLYFEEFLIQDSRGFMILKNN*
Ga0114361_10025045	3300008265	Freshwater, Plankton	VQILHSPARGLEEHVRVSLIFVIIISFMLFTVFTLIYVLYFEEFLIHDSRGFMILKNN*
Ga0114361_10033555	3300008265	Freshwater, Plankton	VRVSLIFAIIISFMLFTVFTLVYVLYSEEFMIHDSRGFMILKNN*
Ga0114361_10036984	3300008265	Freshwater, Plankton	VSVLEEHVRVSLIFAIITSFMLLTVFTLIYILYFEEFPIRDSRGFMIVKNN*
Ga0114361_100532112	3300008265	Freshwater, Plankton	MRVSLIFAIIVSFMLFTVFTFANVLYSEEFLIHDSRGFMIWKNN*
Ga0114361_10054897	3300008265	Freshwater, Plankton	VRVSLVFVIIVSFMLFTVFTLVYVLYFEEFLIHDSRGFMILKNN*
Ga0114361_10062472	3300008265	Freshwater, Plankton	VRVSLIFAIIVSFLLFIVFVYVLYFEEFLIHDSRGFMTLKNN*
Ga0114361_10081424	3300008265	Freshwater, Plankton	VQVSLIFAIIVSFMLFRYSTVFPLVYVLNFEEFLIHDSHGFMILKNN*
Ga0114361_10083692	3300008265	Freshwater, Plankton	MRVGWRNLVRVSLIFAIIVIFMLFAVFPLVYVLYFEEFMILHSRGFMILKNN*
Ga0114361_10088491	3300008265	Freshwater, Plankton	VRVSLIFAIIVSFMLFTVFSLVYVLYFEEFLIHDSRGFMILKKI*
Ga0114361_10089832	3300008265	Freshwater, Plankton	MRVSLIFVIIISFMFFTVFTLVYVLYFEDFLFRDSHGFIILKIN*
Ga0114361_10093931	3300008265	Freshwater, Plankton	VQVSLIFAIIISFMLFTVFTLVYVLYFEEFLIHDSRGFMILKNN*
Ga0114361_10094123	3300008265	Freshwater, Plankton	MLFTYSTVFLLVYVLYFEEFLIHDSRGFMILKNN*
Ga0114361_10094333	3300008265	Freshwater, Plankton	VRVPQIFAIIVSFLLFTVFPFVYVLYFEEFLIHDSLGFMILKKI*
Ga0114361_10096407	3300008265	Freshwater, Plankton	VQVSLIFAIIVSFMLFTVFFLVYVLYFKEFLIHDSRGFMILKNN*
Ga0114361_10107686	3300008265	Freshwater, Plankton	VRVPLIFAIIVSFLLLFTTVFPLVYVLYFEEFLIHDSRGFMILKKI*
Ga0114361_10116385	3300008265	Freshwater, Plankton	VRVSLIFAIFVSFMLFSEFPLVYVLYFEEFLIHDSRGFMILKNN*
Ga0114361_10129816	3300008265	Freshwater, Plankton	MGWAEGKHHVRVSLIFAIIVSFMLFTVFTLVYVLYFEEFPIHNSRGFMILKNN*
Ga0114361_10131453	3300008265	Freshwater, Plankton	VQVSLIFAIIISFMLFTVFPLAYVLYFEEFLIHDSCGFVILKKI*
Ga0114361_10132992	3300008265	Freshwater, Plankton	VRVPLIFAIIVSFMLFTVFPLIYVLYFEEFLIHNSRGFMILKKI*
Ga0114361_10147464	3300008265	Freshwater, Plankton	VRVSLIFAIIISFILFTVFPLVYVLFFEEVLIHDSLGFMILKYI*
Ga0114361_10147994	3300008265	Freshwater, Plankton	VRVSLIFVIIISFMLFTVFPLVYVLYLEEFLIHDSRGFMILKKI*
Ga0114361_10154581	3300008265	Freshwater, Plankton	MQVSLIFAIIVSFMLFTVANVLYFEEFMIQDSPGFMILKNN*
Ga0114361_10196391	3300008265	Freshwater, Plankton	VRVSLIFVIVVSFVLFTVFPLIYILYFEEFLIHDSRGFMILKKI*
Ga0114361_10196691	3300008265	Freshwater, Plankton	VRVSLIFAIIVSFMLFTVFSLMYVLYFEEFLIHDSRGFMILKKI*
Ga0114361_10202943	3300008265	Freshwater, Plankton	VRVSLIFAMIVSFMLFTVFTLVYVLYFEEFLIHDSRGFMILKNN*
Ga0114361_10223703	3300008265	Freshwater, Plankton	VRVSLIFAIIISFMLFTVFPLVYELYFEEFLIHDSHGFVILKKI*
Ga0114361_10229981	3300008265	Freshwater, Plankton	VRVSLIVAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKNY*
Ga0114361_10265833	3300008265	Freshwater, Plankton	MGWRNLERVSLIYAIIVSFLLFTVFPLVYVLYFKEFLIQDSRGFMILKKI*
Ga0114361_10401332	3300008265	Freshwater, Plankton	VRVSLIFGIIVSFMLFTVFTLVYELYFEKILIHNSRGFMILKNS*
Ga0114361_10431772	3300008265	Freshwater, Plankton	VGWRNLVQVSVIFAVIVSFMLFTVFPLVYVLYFKEFLIHDSRGFMILKNN*
Ga0114361_10463513	3300008265	Freshwater, Plankton	IIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKKI*
Ga0114361_10564493	3300008265	Freshwater, Plankton	FAIIVSFMLFTVFPLVYVLYFKEFLIHDSRGFMILKNT*
Ga0114361_10815123	3300008265	Freshwater, Plankton	RVSLIFVIIISFMIFTVFTVANVLYFEEFLIQDSPGFMILKNN*
Ga0114361_10851711	3300008265	Freshwater, Plankton	FAIIVSFMLFTVFPLVYVLYFKEFLIHDSRGFMILKNN*
Ga0114361_11532841	3300008265	Freshwater, Plankton	VQVSLIFAIIVSLMLFTVLTLVYVLYFEEFLIHDSRGFMILKIN*
Ga0114361_12156801	3300008265	Freshwater, Plankton	MRVSLIFAIIVSFMLLTVFPLVYVLYFEEFLINDSRGFMILKNI*
Ga0207193_11200892	3300020048	Freshwater Lake Sediment	MWAGGTSANYPDFSRIIIFMLFTVFTLIYILYFEELLIHDSRGFMILKNN
Ga0208088_10487571	3300020505	Freshwater	MQVSLIFAIILSFMLFTVFTLANVLNFEEFLIHDSRGIMILKNN
Ga0214162_10602701	3300021108	Freshwater	IIVSFMLFTVLFPLVYVLYFEEFLIHDSRGFMILKKI
Ga0334989_0019246_1911_2045	3300033984	Freshwater	MRVSLNFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN
Ga0334989_0042518_279_413	3300033984	Freshwater	MRVSLIFAIIVSFMLFNVFALANELYFEEFLNHDSRGFMILKNN
Ga0334989_0136231_625_759	3300033984	Freshwater	MQVSLIFVIIVSFMLFTVFTLANELYFDEFLIHDSRGFIILKNN
Ga0334989_0297680_93_227	3300033984	Freshwater	MRVSLIFAIIVSFMLFTVFTLAYVLYFEEFLIRDSRGFMILKNN
Ga0334989_0456841_3_128	3300033984	Freshwater	TLIFSRIISFMLFTVFTLPSVLYFEEFLIHYSRGFMSLKNN
Ga0334989_0597119_370_528	3300033984	Freshwater	ACGLEEHIMLVSLIFVIFVSFMFFIVFTLANVLYFEEFLIHDSCGFMILKNN
Ga0335005_0030224_3426_3560	3300034022	Freshwater	MRVSLIFVIIISFKLFNVFTLANVLYFEEFLIHDSRGSMILKNN
Ga0335005_0032610_1642_1776	3300034022	Freshwater	MQVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSCGFMILKNS
Ga0335005_0044135_2_127	3300034022	Freshwater	SLIFAIIVSFMLFTVFTLANVFYSEEFLINNSGGFMILKNN
Ga0335005_0063733_10_144	3300034022	Freshwater	MRVSLIFVIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN
Ga0335005_0360038_1_153	3300034022	Freshwater	RGLEEHVRVSLIFAIIISFMLFTVFTLANVLYFKAFMIHDSRGFMILKNN
Ga0335005_0360149_721_846	3300034022	Freshwater	FLIFAIIVIFMSFTVFTLANVLYFQEFMNHESCGFMILKNN
Ga0335005_0509010_555_668	3300034022	Freshwater	AIIVSLMLFTVFTLANVLYFEEFLIHDSRGFIILKNN
Ga0335005_0617955_2_124	3300034022	Freshwater	LIFAIIISFMLFIVVTLANVLYFEEFMIHYSRGFMILKNN
Ga0335005_0767477_3_113	3300034022	Freshwater	IIVSFMLFTVFTLANVLYFEEFMIHDSCGFMILKNN
Ga0335001_0592385_2_109	3300034064	Freshwater	MQVSLIFAIIISFMLYTVFTLANILYFEEFLIHDSR
Ga0335001_0742295_402_509	3300034064	Freshwater	IVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNS
Ga0334990_0148262_1152_1280	3300034068	Freshwater	VSLIFVIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN
Ga0334990_0390662_629_748	3300034068	Freshwater	MRVSLIFAIIVSFMLFTMFTLAYVLYFEEFLIHYSCGFYD
Ga0334990_0527845_475_624	3300034068	Freshwater	AGEEHVRVSLIFAIIVSFMLFTVFTLANVLYFEEFMIHDSRGFMILKNN
Ga0335022_0673048_3_131	3300034095	Freshwater	VSLIFVIIVSFMLFTAFTLANVLYFKEFLIHDSRGFMILKNN
Ga0335025_0467467_531_641	3300034096	Freshwater	LIFVIIVSFMLCTVFTLVYVFYFEEFLIHDSRGFMI
Ga0335037_0382183_1_129	3300034107	Freshwater	MQVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKN
Ga0335037_0730112_233_388	3300034107	Freshwater	MRGLEEHVRVSLNFAIIVSFMFFSVFTLANVLYFEEFLIHDSCGFMILKNN
Ga0335017_0012327_1717_1908	3300034167	Freshwater	MVTLTASGLEDHMQVSLIFAIIVSLMFFTVFTVFTVFTLAYVLYFEEFLIHDSHGFIILKNTN
Ga0335017_0042082_1399_1533	3300034167	Freshwater	MQVSQIFAIIVSFMLFTVFTLANVLCFEEFLIHDSRGFMILKNN
Ga0335017_0281682_786_929	3300034167	Freshwater	MRVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNICLNL
Ga0335017_0295374_86_220	3300034167	Freshwater	MRVSLIFAIIVSFLLFTVFTLASVLYFEEFLIHDSCGFMIFKNN
Ga0335017_0302341_73_207	3300034167	Freshwater	MRVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFLILKNN
Ga0335017_0477785_556_663	3300034167	Freshwater	IVSFMFFTVFTLANVLYLEEFMIHDSRGFMILKNN
Ga0335061_0004623_4088_4243	3300034168	Freshwater	MRGLEEHMQVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSCGFMILKNS
Ga0335061_0006562_4707_4841	3300034168	Freshwater	MRVSLIFAIIVSFMLFTVFTLANVLYIEEFLIRNSRGFMILKNN
Ga0335061_0012527_3785_3919	3300034168	Freshwater	MRVSLIFTIIVSYMLFTVFTVANVLYFEEFLIHDSRGFMILKNS
Ga0335061_0044964_2126_2260	3300034168	Freshwater	MRVFLIFAITVSFMLFTVFTLANVLYFEEFLIHDSRGFLILKNH
Ga0335061_0079252_1588_1749	3300034168	Freshwater	LAAHGLEEHVRVSLIFAIIISFMLFTVFTLANVLYFKAFMIHDSRGFMILKNN
Ga0335061_0472587_504_641	3300034168	Freshwater	IMRVSLIFAIIVSFMLFTVITLANVLYFEEFLIHDSCEFMILKNN
Ga0335061_0592596_405_539	3300034168	Freshwater	MQVSLIFAIIVSFMLFTEFTLANVLYFKAFLIHDSRGFMVLKNS
Ga0335061_0627172_160_294	3300034168	Freshwater	MRVSLIFVIIVSFMLFTVFTLANVLYFEEFTIHDSSGFMIMKNN

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F094926

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign